KEGG   Streptomyces avermitilis: SAVERM_339
Entry
SAVERM_339        CDS       T00126                                 

Gene name
ldhA
Definition
(GenBank) putative lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00270  Cysteine and methionine metabolism
sma00620  Pyruvate metabolism
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_339 (ldhA)
   00620 Pyruvate metabolism
    SAVERM_339 (ldhA)
   00640 Propanoate metabolism
    SAVERM_339 (ldhA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAVERM_339 (ldhA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_339 (ldhA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     SAVERM_339 (ldhA)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   SAVERM_339 (ldhA)
  Exosomal proteins of breast milk
   SAVERM_339 (ldhA)
SSDB
Motif
Pfam: Ldh_1_N Shikimate_DH F420_oxidored Sacchrp_dh_NADP Ldh_1_C TrkA_N ApbA 2-Hacid_dh_C KR 3HCDH_N NAD_binding_7 GGDEF_2 ThiF
Other DBs
NCBI-ProteinID: BAC68048
NITE: SAV0339
UniProt: Q82R06
Position
complement(394813..395724)
AA seq 303 aa
MGSVGVVGAGAVGQTVAATLVASGICPRLLVVSRTVEQARALAADLDDMRQTTGSPVQPE
ARRVADLIGCHAVVVAVRAAFTNTRAADVRMGGALTNAPVIRALATTLRGYQGTVLVVTN
PVDLMTRLFAETSGCPRVYGIGSNLDSARYRLTLAHLLDVPATTVHGHVIGEHGDGAVVC
ASSTTVNGTPAAVPLAEVRAELRTRPGQISAGVGRTRSGPAGAVLSTLRKALGLVDGTEE
LTAEHRGDWLGIPLRFTAGQPVACLPALNADEDAQLAATATKLRDAYQALRPSGPTPNSQ
ETT
NT seq 912 nt   +upstreamnt  +downstreamnt
gtgggctcggtcggtgtcgtcggtgccggcgccgtcggccagaccgtcgcggccacgctg
gtggcctccggcatctgccctcgcctgctcgtcgtctcccgcaccgtcgagcaggcgagg
gcgctggccgctgacctcgacgacatgcgccagaccaccggatcgcccgtgcagcccgaa
gcccgccgggtggcggacctgatcggctgccacgccgtggtcgtcgccgtgcgggccgcg
ttcaccaacacccgtgccgccgacgtacggatgggcggcgcgttgaccaacgctcccgtg
atccgtgctctggccacgacactgcgcggctaccaggggaccgtgctcgtggtcaccaac
ccggtcgacctgatgacccggctgttcgccgagacctccggctgcccgcgcgtgtacgga
atcggctcgaacctcgactccgcccgctaccggctcaccctggcccacctgctcgacgtg
cccgcaaccaccgtgcacggccacgtcatcggcgaacacggggacggtgcggtggtgtgc
gcctcgtcgaccaccgtcaacggcacgcccgccgccgtcccccttgcggaggtacgcgcg
gaactgcgtacccgccccggccagatcagcgcgggcgtcggccgcacccgctccggaccc
gccggcgcggtgctgtccactctgcgcaaggccctcggcctggtcgacggcaccgaggaa
ctgactgccgaacaccgcggcgactggctcggaattccgttgcgcttcaccgccggccag
cccgtagcgtgcctgcccgccctcaacgcggacgaagacgcgcaactggccgcgaccgcc
accaaactccgtgacgcctaccaggcgttacggccgtccggacccacacccaactcccag
gagacgacgtga

DBGET integrated database retrieval system