KEGG   Streptomyces avermitilis: SAVERM_3442Help
Entry
SAVERM_3442       CDS       T00126                                 

Gene name
folD1
Definition
(GenBank) putative methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00670  One carbon pool by folate
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_3442 (folD1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     SAVERM_3442 (folD1)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     SAVERM_3442 (folD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH Hydrolase
Motif
Other DBs
NCBI-ProteinID: BAC71154
NITE: SAV3442
UniProt: Q82HR6
Position
complement(4265904..4266758)
Genome map
AA seq 284 aa AA seqDB search
MTAQILDGKATAAAIKSDLTARVAALKEKGVTPGLGTILVGDDPGSQKYVAGKHRDCAQV
GIASIQRELPATATQEEIEAAVRELNEDPACTGYIVQLPLPKGIDENRILELMDPDKDAD
GLHPMNLGRLVLNEPAPLPCTPNGVLTLLRRYGVEIKGAEVVVVGRGVTIGRPMPLLLTR
RSENATVTQCHTGTRDLSSHLKRADIIVAAAGSAHLIRPEDVKPGAAVLDVGVSRSAEGK
IVGDVHPGVAEVAGWISPNPGGVGPMTRAQLLVNVVEAAERSVG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagattctcgatggcaaggccaccgcagccgcgatcaagtccgatctgacc
gcccgcgtggcggccctcaaggaaaagggtgtgacgcccggcctcggcacgatcctcgtc
ggggacgaccccggcagccagaagtacgtcgcgggcaagcaccgcgactgcgcccaggtc
ggcatcgcctccatccagcgggagctgcccgcgaccgccacgcaggaggagatcgaggcg
gccgtacgcgagctgaacgaggacccggcctgcaccggctacatcgtccagctgccgctg
cccaagggcatcgacgagaaccgcatcctggagctgatggacccggacaaggacgcggac
ggcctgcacccgatgaacctcggccgcctcgtcctgaacgagccggcccccctgccctgc
accccgaacggcgtcctcaccctgctccgccgctacggcgtggagatcaagggcgcggag
gtcgtggtcgtcggccgcggcgtgaccatcgggcgtccgatgccgttgctgctgacgcgg
cgcagcgagaacgcgacggtcacgcagtgccacaccggtacgcgcgacctctcctcgcac
ctcaagcgcgccgacatcatcgtcgccgcggcgggttccgcgcacctgatccggcccgag
gacgtgaagccgggcgcggccgtgctcgacgtcggtgtctcgcgcagcgccgagggcaag
atcgtcggcgatgtccaccccggtgtcgccgaggtggccggctggatctccccgaacccg
ggcggcgtcggcccgatgacccgcgcccagctgctcgtcaatgtggtcgaggcggcggag
cgcagtgtcggctga

DBGET integrated database retrieval system