KEGG   Streptomyces avermitilis: SAVERM_3445Help
Entry
SAVERM_3445       CDS       T00126                                 

Gene name
purN
Definition
(GenBank) putative phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00230  Purine metabolism
sma00670  One carbon pool by folate
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Module
sma_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_3445 (purN)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_3445 (purN)
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     SAVERM_3445 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N SSURE
Motif
Other DBs
NCBI-ProteinID: BAC71157
NITE: SAV3445
UniProt: Q82HR3
Position
complement(4269414..4270043)
Genome map
AA seq 209 aa AA seqDB search
MAAKPVAKRLVVLVSGSGTNLQALLDAIEAQGIEAYGAEIVAVGADRDGIEGLARAERAA
LPTFVRRVKDYDTRDEWDAALTEAVAAYEPDLVVSAGFMKIVGKEFLARFGGRFVNTHPA
LLPSFPGAHGVREALAYGVKVTGCTVHFVDDGVDTGPIIAQGVVEIRDEDDESALHERIK
EVERRLLVEVVGRLARNGHRIEGRKVVIP
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccaagcccgtggccaagcgcctcgtcgtgctggtttccggatccggtacgaat
ctgcaggctctcctcgacgccatcgaggcccagggcatcgaggcctacggggcggagatc
gtcgccgtcggcgccgaccgcgacggcatcgaaggcctcgcccgcgccgagcgtgcggcc
ctgccgaccttcgtccgccgggtgaaggactacgacacccgtgacgagtgggacgcggcg
ctgaccgaggccgtcgccgcgtacgaacccgatctcgtcgtctccgccgggttcatgaag
atcgtggggaaggaattcctcgccaggttcggcggtcggttcgtgaacacgcaccccgcc
ctgctgcccagttttcccggggcccacggcgtgcgcgaggcactcgcgtacggcgtgaag
gtcaccggatgcaccgtccacttcgtcgacgacggtgtcgacaccggaccgatcatcgct
cagggcgtggtggagatccgggacgaggacgacgagagcgctctgcacgagcgcatcaag
gaagtcgagcgaaggctgctcgtcgaggtcgtggggcggctcgcccgcaacggccatcgc
attgagggacgaaaggtagttatcccgtga

DBGET integrated database retrieval system