KEGG   Streptomyces avermitilis: SAVERM_3517
Entry
SAVERM_3517       CDS       T00126                                 

Gene name
pobA
Definition
(GenBank) putative p-hydroxybenzoate hydroxylase
  KO
K00481  p-hydroxybenzoate 3-monooxygenase [EC:1.14.13.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00362  Benzoate degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_3517 (pobA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.2  4-hydroxybenzoate 3-monooxygenase
     SAVERM_3517 (pobA)
SSDB
Motif
Pfam: FAD_binding_3 NAD_binding_8 Pyr_redox_3 DAO Pyr_redox_2 Lycopene_cycl Amino_oxidase HI0933_like ApbA
Other DBs
NCBI-ProteinID: BAC71229
NITE: SAV3517
UniProt: Q82HJ1
Position
complement(4351218..4352609)
AA seq 463 aa
MRTTVGIIGAGPAGLLLARLLRNAGIDSVVLESRDRAYVERRQRAGILEQGTVDVLRAAG
AGERMDREGLRHDGIELRFDRRRHRVDFPALAGGRAVMVYAQTEVCKDLIALQLEEGGPL
LFGAEALAVEGAGTERPRVPFTHEGREDVLECDYVVGCDGFRGVARQAVPAEVSRVFERT
YPFGWLGVLADVAPSHDELVYARHERGFALLSMRSPAVSRLYLQVPEGTDAEAWADDEIW
AELERRFETDDAWRLERGPITQKSVTPMRGYVHEPMRHGRLFLAGDAAHIVPPTGAKGLN
LAVGDVVTFARALTHLKETGSGERLDAYSATCLRRVWQAERFSYDMTTLLHRPPAATPFE
ERVQLARLERITSSRAAEADLAEGYTGSPWSDPNGRSAAGRSPAGRRRMTDRAPNGHRTT
TGRAPCYGFVPVLAGHGTHAYRGSTGERSFLSSRVNPLPTYYS
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgcgtaccaccgtcgggatcatcggggccggaccggccggactgctgctggcccggctg
ctgcgcaacgccgggatcgactcggtggttctggagagccgggaccgggcgtacgtggag
cggcgccagcgcgccgggatcctcgagcaggggaccgtcgacgtgctgcgggccgccggg
gccggggagcggatggaccgggaagggctgcggcacgacgggatcgagctgcggttcgac
cggaggcggcaccgcgtcgacttccccgcgctcgccggcggccgcgccgtgatggtgtac
gcgcagaccgaggtgtgcaaggacctcatcgcgctccagctcgaggagggcggaccgctg
ctcttcggcgccgaggcgctcgccgtggagggggcagggacggagcggccgcgcgtgccg
ttcacccacgaggggcgcgaggacgtcctggagtgcgactacgtcgtgggctgcgacgga
ttccggggcgtcgcccggcaggccgtgcccgccgaggtgtcgcgcgtcttcgaacgtacg
tatcccttcggctggctcggcgtcctcgccgatgtcgccccctcccacgacgaactcgtc
tacgcccgccacgaacgcggcttcgccctgctcagcatgcgctcgccggccgtctcccgg
ctctacctccaggtgcccgagggcacggacgccgaggcctgggcggacgacgagatctgg
gcggagctggagcggcgcttcgagacggacgacgcctggcggctggagcgcgggccgatc
acccagaagtccgtcacccccatgcgcggctacgtccacgagcccatgcggcacggccgg
ctcttcctcgccggggacgcggcgcacatcgtgccgccgaccggggccaagggcctcaac
ctcgccgtcggggacgtcgtgaccttcgcgcgggcgctgacgcacctgaaggagacggga
tcgggcgagcgcctcgacgcgtactccgcgacctgtctgcgccgcgtctggcaggccgag
cggttctcgtacgacatgacgaccctgctgcaccgcccgccggccgccacgccgttcgag
gagcgcgtccagctggcccgcctggagcggatcacgtcctcccgcgccgccgaggccgac
ctcgcggaggggtacaccggttccccctggagtgacccgaacgggcgctcggccgccggc
cggtcgccggccggtcgtcggcggatgactgaccgggcgccgaacgggcaccggaccact
accggtcgagcgccctgttacggcttcgtaccagtgctcgccgggcatgggacacacgcg
taccgtggcagcacaggggaaagatccttcttaagcagtagggtcaatcctttgcctacc
tattactcttga

DBGET integrated database retrieval system