KEGG   Streptomyces avermitilis: SAVERM_3533Help
Entry
SAVERM_3533       CDS       T00126                                 

Gene name
eno
Definition
(GenBank) putative enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
sma03018  RNA degradation
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00002  Glycolysis, core module involving three-carbon compounds
sma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_3533 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_3533 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_3533 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sma03019]
    SAVERM_3533 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_3533 (eno)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     SAVERM_3533 (eno)
Messenger RNA biogenesis [BR:sma03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SAVERM_3533 (eno)
Exosome [BR:sma04147]
 Exosomal proteins
  Proteins found in most exosomes
   SAVERM_3533 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: BAC71245
NITE: SAV3533
UniProt: Q82HH5
Position
complement(4372251..4373537)
Genome map
AA seq 428 aa AA seqDB search
MPSIDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYQ
GKGVEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAH
AASEASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALR
WGAEVYHTLKKVLKTKGLSTGLGDEGGFAPNLESNRAALDLIIEAIKQAGYIPGEQIALA
LDVAASEFYKDGKYEFEGKSRSAAEMTEYYEELVSAYPLVSIEDPLYEDDWAGWKVITDK
LGDKVQIVGDDLFVTNPERLARGIEEGSANALLVKVNQIGSLTETLDAVELAQRNGFKCM
MSHRSGETEDVTIADLAVAVNCGQIKTGAPARSDRVAKYNQLLRIEEILDDAAEYAGRSA
FPRFRSAN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtccatcgacgtcgtcgtagcccgggaaatcctggactcccgaggcaaccccacg
gtcgaggtcgaggtcggcctcgacgacggcagcacgggtcgtgccgccgtcccgtccggc
gcctccaccggtgccttcgaggccatcgagctccgcgacggtgaccccaaccgttaccag
ggcaagggtgtcgagaaggccgtcctcgccgtcatcgagcagatcggcccggagctcgtc
ggctacgacgccaccgagcagcgcctgatcgaccaggcgatgttcgacctggacgccacc
gacaacaagggctcgctcggcgccaacgccatcctcggcgtctccctcgccgtcgcgcac
gccgcctccgaggccagcgacctcccgctcttccgctacctgggcggcccgaacgcgcac
ctgctgcccgttccgatgatgaacatcctgaacggcggctcgcacgccgactccaacgtg
gacatccaggagttcatgatcgccccgatcggcgcggagtccttctccgaggccctgcgc
tggggcgccgaggtctaccacaccctcaagaaggtgctgaagaccaagggcctgtccacc
ggcctcggcgacgagggcggcttcgccccgaacctggagtcgaaccgcgccgcgctcgac
ctcatcatcgaggccatcaagcaggccggttacatcccgggcgagcagatcgcgctcgcg
ctcgacgtcgccgcgtccgagttctacaaggacggcaagtacgagttcgagggcaagtcc
cgctcggccgccgagatgaccgagtactacgaggagctcgtctccgcgtacccgctcgtc
tccatcgaggacccgctgtacgaggacgactgggccggctggaaggtcatcaccgacaag
ctgggcgacaaggtccagatcgtcggcgacgacctcttcgtcaccaacccggagcgcctg
gcccgcggcatcgaggagggctccgccaacgccctgctcgtcaaggtcaaccagatcggt
tcgctgaccgagaccctggacgccgtcgagctggcccagcgcaacggcttcaagtgcatg
atgtcccaccgctccggcgagaccgaggacgtcaccatcgccgacctcgccgtcgccgtg
aactgcggtcagatcaagaccggcgccccggcccgctcggaccgtgtcgccaagtacaac
cagctgctgcgcatcgaggagatcctcgacgacgccgccgagtacgccggccgctcggcg
ttcccccggttccgctcggcgaactga

DBGET integrated database retrieval system