KEGG   Streptomyces avermitilis: SAVERM_3675Help
Entry
SAVERM_3675       CDS       T00126                                 

Gene name
pacB1
Definition
(GenBank) putative penicillin acylase, secreted
  KO
K01434  penicillin G amidase [EC:3.5.1.11]
Organism
sma  Streptomyces avermitilis
Pathway
sma00311  Penicillin and cephalosporin biosynthesis
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SAVERM_3675 (pacB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sma01002]
    SAVERM_3675 (pacB1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.11  penicillin amidase
     SAVERM_3675 (pacB1)
Peptidases and inhibitors [BR:sma01002]
 Serine peptidases
  Family S45
   SAVERM_3675 (pacB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Penicil_amidase
Motif
Other DBs
NCBI-ProteinID: BAC71387
NITE: SAV3675
UniProt: Q82H71
Position
complement(4549001..4551811)
Genome map
AA seq 936 aa AA seqDB search
MPPNTTASSGEQPGKSGRKKGRKARLLVIVLVLAIIGGIGFGAYWSISTVRASFPQTKGS
ITLDGLAGPVDVKRDGYGIPQIYASSDADLFMAQGYVQAQDRFYEMDVRRHMTSGRLSEM
FGKGQVKKDEFLRTLGWDRVAKKEYDTKLSAATKKYLRAYAKGVNAYLEGKDGKDISLEY
AALGFTNDYQPQKWTPVDSVSWLKAMAWDLRGNMQEEIDRSLMTSRLGPKQIADLYPDYP
YSRNKTIVQEGQYNELTKAFEQGGSTGTQSTTGGTSTGTSGTSGTSGTTGSTSASGTSTS
ASDPSALESQLTGLYKLLDDVPTAVGVNGNGIGSNSWVVSGDHTITGKPLLANDPHLSAS
LPSVWYQMGLHCRSVSSKCQYDVSGYTFAGMPGVVIGHNQAIAWGMTNSGVDVTDLYLEK
LSGDGYLYDDKVLPFTSHDETIKVAGGRSKTIVVRETNNGPLLSDRNDELVKVGKKATVD
TAAPDRGDGYGIALKWTALAPGNSMDAVFELDKAANWSEFRKAAASFDVPSQNLVYADKD
NIGYQLPGKIPTRAKGDDGSLPVPGWDSKYQWTGYIEQDELPYEYNPDRGYIVTANQAVV
DKDKYPYTLTTDWGYGSRSQRIADLIESKIKGGGKISTDDMRQMQLDNSSEIAKLLVPKL
LKLDVADKHVREAQKLLEGWDYTQDADSAAAAYFNAVWRNVLKLAFGNKLPKELRVQGQC
LYVDPAESTGPADQDQKVRECGQRDADQAQPDGGDRWFEVVRSLMDDENNDWWTSPKSRT
DEATDTRDELFARAMKDARWELTAKLGKNMDTWSWGRLHRLFLKNQTLGTEGPDVVKYVL
NRGPWKLSGGEATVNASGWNAAGGYGVVWVPSMRMVVNLGDLDKSKWINLSGASGHAFSA
HYTDQTDKWAKGELLPWAFSEKAVDGSTSDSLVLKP
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaacaccaccgcctcttccggtgagcagcccggcaagtccggcaggaagaag
gggcgcaaagcccgtttgctcgtgatcgtcctggttctggccatcatcggaggcatcggc
ttcggtgcgtactggagcatcagtacggtccgcgcctcgttcccgcagaccaagggctcg
atcaccctcgacggcctggccgggccggtcgacgtgaagcgcgacggctacggcatcccg
cagatctacgcctcgtccgacgcggacctgttcatggcgcagggctacgtccaggcgcag
gaccggttctacgagatggacgtgcgccgccacatgacctcggggcgcctgtcggagatg
ttcggcaaggggcaggtcaagaaggacgagttcctgcgcaccctgggctgggaccgggtg
gcgaagaaggagtacgacaccaagctgtcggccgccacgaagaagtacctccgggcgtac
gccaagggagtcaatgcctacctcgagggcaaggacggcaaggacatctccctggagtac
gccgcccttggtttcaccaacgactaccagccccagaagtggaccccggtcgactcggtc
tcctggctcaaggcgatggcctgggacctgcgcggcaacatgcaggaagagatcgaccgc
tccctgatgaccagccgcctgggccccaagcagatcgctgacctgtacccggactacccg
tacagccgtaacaagacgatcgtccaggagggccagtacaacgagctcaccaaggcgttc
gagcagggtggctccacgggcacgcagtccacgaccggggggacgtcgaccgggacctcg
gggacctcggggacctcggggaccacgggctcgacctcggcctcggggacttccacgtcg
gcctcggacccctcggccctggagagccagctgacgggcctctacaagctcctggacgac
gtccccaccgccgtcggcgtgaacggcaacggcatcggctccaactcctgggtcgtctcc
ggcgaccacaccatcaccggcaagccgctgctggccaacgacccgcacctgtcggcctcg
ctgccgtcggtctggtaccagatgggcctgcactgccgcagcgtctccagcaagtgccag
tacgacgtctccggctacaccttcgcgggcatgcccggcgtggtcatcggccacaaccag
gccatcgcctggggcatgaccaactccggggtcgacgtcaccgacctctacctggagaag
ctcagcggcgacggctacctgtacgacgacaaggtgctgccgttcacgtcccacgacgag
accatcaaggtcgcgggcggcaggagcaagacgatcgtcgtccgcgagaccaacaacgga
cccctgctgtccgaccgcaacgacgaactcgtcaaggtcggcaagaaggccaccgtcgac
acggcggcgcccgaccgcggcgacggctacggcatcgcgctgaagtggaccgccctggcg
ccgggcaactccatggacgccgttttcgagctggacaaggcggcgaactggtcggagttc
cgcaaggcggccgcgtccttcgacgtgccctcgcagaacctggtctacgccgacaaggac
aacatcggctaccagctgcccggcaagatccccacgcgcgcgaagggtgacgacggctcg
ctcccggtgcccggctgggactccaagtaccagtggaccggctacatcgagcaggacgag
ctgccctacgagtacaacccggaccgcggctacatcgtcaccgccaaccaggccgtcgtc
gacaaggacaagtacccctacacgctcaccacggactggggctacggctcccgcagccag
cggatcgccgatctcatcgagtcgaagatcaagggcggcggcaagatctcgaccgacgac
atgcgccagatgcagctcgacaacagcagcgagatcgccaagctcctggtgcccaagctg
ctcaagctcgatgtcgccgacaagcatgtgcgtgaggcgcagaagctcctcgagggctgg
gactacacccaggacgccgactcggcggcggccgcgtacttcaacgcggtgtggcgcaac
gtcctcaagctcgccttcggcaacaagctgcccaaggagctgcgggtccagggccagtgc
ctgtacgtcgatccggccgaaagcaccggtcccgcggaccaggaccagaaggtgcgcgag
tgcggccagcgcgacgcggaccaggcacagccggacggcggagaccgctggttcgaggtg
gtccgctccctcatggacgacgagaacaacgactggtggacgtcgcccaagtcgcgcacc
gacgaggcgaccgacacgcgtgacgagctgttcgcacgggcgatgaaggacgcccgctgg
gagctgaccgccaagctcggcaagaacatggacacctggagctggggccggctgcaccgc
ctgttcctgaagaaccagaccctcggcaccgaaggtccggacgtcgtgaagtacgtgctc
aaccgcggcccctggaagctcagcggcggcgaggcgacggtcaacgcgtccggctggaac
gcggcgggcggctacggcgtcgtctgggtgccgtccatgcgcatggtggtcaacctcggg
gacctcgacaagtccaagtggatcaacctgtccggcgcctcgggacacgccttcagcgcc
cactacaccgaccagacggacaagtgggccaagggcgagctgctgccgtgggccttctcc
gagaaggcggtcgacgggagcacgagcgactcgctggtactgaagccgtga

KEGG   Streptomyces avermitilis: SAVERM_4171Help
Entry
SAVERM_4171       CDS       T00126                                 

Gene name
pacB2
Definition
(GenBank) putative penicillin acylase
  KO
K01434  penicillin G amidase [EC:3.5.1.11]
Organism
sma  Streptomyces avermitilis
Pathway
sma00311  Penicillin and cephalosporin biosynthesis
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SAVERM_4171 (pacB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sma01002]
    SAVERM_4171 (pacB2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.11  penicillin amidase
     SAVERM_4171 (pacB2)
Peptidases and inhibitors [BR:sma01002]
 Serine peptidases
  Family S45
   SAVERM_4171 (pacB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Penicil_amidase XPB_DRD HTH_32
Motif
Other DBs
NCBI-ProteinID: BAC71883
NITE: SAV4171
UniProt: Q82FT1
Position
complement(5119416..5121623)
Genome map
AA seq 735 aa AA seqDB search
MTIEIYRDAWGIPHLRAGGARELARAQGRVTAVDRAWQLEVERHRARGTSASFLGTEAAA
WDVFARRSRLDDTARRCFAALERTDPETADWVRAYVDGVNEGLAEGARRAPEFAATGLVP
GRWEPWTPLGVWLGTHILFAGFPAKLWREEVVRRLGDEAVGLFATDGPGTAGSNGWLVSG
ERTVTGQPVIAGDPHRFIEDPGVYQQIRLSCPEFDVVGLAVPGVPGIAHFAHTGKVAWAI
TNAMADYQDLYRERLRRTPDGNGNGNGIGDGTGTGDGAGGGAGVEALDPDGTWRPAARHT
ETVEVAGGDPVEVEVIETARGPVVIGGVTGSGDDPISLRYPPRVTEDLGFSALLPLLRAR
EVADVDRAFDLWAEPVNVVQAADTEGGLLHRVAGNVPLRGRDNRTRLVPAWEPGHEWHGW
HEMPRGTVEDGLAVMANQRGPATPLGVEFAPPHRAARIRELLEERPTWSAPDMAAIHMDT
HLASAGALLDHLAALDGLTPQASALRDRLLSWDRRMTAASTEAAQYAELRGAVVRRLAAH
PAFTALTDPPAYPEVFRPWLALLPRVGFALENLLKADELYGIDRAAVVREAVAEVAAETA
GKAAAETVKAAGASGTWGDTHRLAPWRALPTAAYAAPASPASYAYDEPGLSGDHDCVLCT
SAVPGLTDLSARGPAARYVWDLARREDSRWVVPFGASGVPGSPHHRDQLPLWLKGDLAPV
VTDWEHLTKENSDDR
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgagatctaccgcgacgcctggggcatcccgcatctgcgggccggcggcgca
cgcgaactcgcccgcgcccagggccgggtcacggccgtcgaccgggcgtggcagctggag
gtcgagcggcatcgcgcgcggggcacctcggcgtccttcctcggtacggaggccgcggcc
tgggacgtgttcgcgagacggtcccgcctcgacgacacggccagacgctgcttcgccgcc
ctggagcggacggacccggagacggcggactgggtccgggcgtacgtggacggtgtcaac
gagggtctggccgaaggggcccgccgcgcaccggagttcgcggccaccggtctggtcccc
ggccgttgggagccctggactccgctgggcgtctggctcggtacgcacatcctgttcgcc
ggcttccccgccaagctgtggcgcgaggaggtcgtacggcggctgggtgacgaggcggtc
ggtctgttcgccaccgacgggccgggcaccgccggcagcaacggctggctggtgagcggc
gaacggacggtcaccgggcagccggtcatcgcgggcgacccgcaccgcttcatcgaggac
cccggcgtctaccagcagatccgcctctcctgccccgagttcgacgtcgtcggcctcgcc
gtcccgggcgttcccggcatcgcccacttcgcccacacgggcaaggtcgcctgggccatc
accaacgcgatggcggactaccaggacctgtaccgcgagcggctgcggcgcaccccggac
gggaacgggaacgggaacggaatcggagacgggaccgggaccggggacggagccgggggc
ggggcgggcgtcgaggccctggacccggacggcacgtggcggcccgcggcgcggcacacg
gagacggtcgaggtggccgggggcgacccggtcgaggtggaggtgatcgagaccgcccgc
gggcccgtcgtcatcggcggcgtcaccggaagcggcgacgatccgatcagcctccgctac
ccgccccgcgtcaccgaggacctaggcttcagcgccctcctccccctcctgcgcgcccgc
gaggtcgccgatgtggaccgggcgttcgacctctgggccgagccggtgaacgtcgtccag
gcggcggacaccgagggcggtctgctgcaccgcgtcgccggaaacgtgcccttgcgcggc
cgggacaaccgcacgcggctcgtccccgcctgggagcccggtcacgagtggcacggctgg
cacgagatgccgcgcgggacggtcgaggacggcctcgccgtgatggcgaaccagcgcggc
ccggcgacccccctcggcgtcgagttcgccccgccccaccgcgcggcccgcatccgcgaa
ctgctggaggagcggcccacctggtcggccccggacatggcggccatccacatggacacc
catctcgcctccgcgggagccctgttggaccacctggccgccctcgacggcctgaccccg
caggcgtccgccctgcgcgaccgcctcctgagctgggaccgccggatgacggccgccagc
acggaggcggcccagtacgcggagctgcgcggcgcggtcgtacggcgcctggccgcgcac
cccgccttcaccgcgctgaccgacccgcccgcctacccggaggtcttccgcccctggctc
gccctcctcccccgcgtcggcttcgccctcgaaaacctgctgaaggcggacgagctgtac
ggcatcgaccgcgccgccgtcgtccgggaggccgtcgcggaggtggccgcggagacggcc
gggaaggcggccgcggagacggtcaaggcggcgggagcgtccggcacctggggcgacacc
caccgcctggccccctggcgcgcgctccccaccgccgcgtacgccgcgccggcctcgccc
gcctcgtacgcgtacgacgaacccggtctgtcgggcgaccacgactgcgtgctgtgcacc
tccgcggtcccggggctgaccgacctcagtgcgcgcggccccgccgcccgctacgtctgg
gacctcgcacggcgcgaggacagccgctgggtggtcccgttcggcgcctcgggtgtcccc
ggctcaccgcaccaccgcgaccagctccccttgtggctcaagggggacctcgccccggtc
gtcaccgactgggagcacctcacgaaggagaactccgatgaccgctga

DBGET integrated database retrieval system