KEGG   Streptomyces avermitilis: SAVERM_3824
Entry
SAVERM_3824       CDS       T00126                                 

Gene name
pdxH2
Definition
(GenBank) putative pyridoxamine 5'-phosphate oxidase
  KO
K00275  pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00750  Vitamin B6 metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAVERM_3824 (pdxH2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.5  pyridoxal 5'-phosphate synthase
     SAVERM_3824 (pdxH2)
SSDB
Motif
Pfam: Putative_PNPOx PNP_phzG_C Pyridox_oxase_2
Other DBs
NCBI-ProteinID: BAC71536
NITE: SAV3824
UniProt: Q82GS3
Position
4726745..4727401
AA seq 218 aa
MGTDLHELLRSLRVWDVELPSFDPASAPAEPLPLFVEWFAEAVAAGQTEPHTMTLATSDE
DGLPDVRIVMLHGADADGWAFATHATSRKGRQLAARPYAALSFYWPTQGRQIRLRGPVEV
APAQEGQADLHARSTGALAAALVGRQSEVLGSMEELGRASDGAWDRAQSDPDAPAPTWTL
YRLRPEEVEFFQGDARRRHVRLVYRRTEEGWLKELLWP
NT seq 657 nt   +upstreamnt  +downstreamnt
atgggaacggatcttcacgagctgctcaggtcactgcgggtgtgggacgtagagctaccc
tccttcgacccggcatccgcacccgccgaaccactcccgctgttcgtggagtggttcgcg
gaggcggtcgcggcgggccagaccgagccgcacacgatgacgctcgcgacgtcggacgag
gacggcctgcccgacgtccgcatcgtgatgctgcacggcgcggacgcggacggctgggcc
ttcgcgacccatgccaccagccgcaagggccgccagctggccgcccgcccgtacgcggct
ctgagtttctactggcccactcagggccgtcagatccggctgcggggcccggtcgaggtc
gccccggcccaggaggggcaggcggatctgcacgcccgctccacgggggcgctggccgcc
gcgctcgtcggcaggcagagtgaagtgctcggttcgatggaggagctggggcgggcctcg
gacggcgcctgggaccgcgctcagagcgaccccgacgcccctgccccgacctggaccctc
taccgcctccggccggaagaggtggagttcttccagggagacgcgaggcgtcggcacgta
cggctcgtctaccgacgcacggaggagggctggctcaaggaactgctgtggccgtga

KEGG   Streptomyces avermitilis: SAVERM_3858
Entry
SAVERM_3858       CDS       T00126                                 

Gene name
pdxH1
Definition
(GenBank) putative pyridoxamine 5'-phosphate oxidase
  KO
K00275  pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00750  Vitamin B6 metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAVERM_3858 (pdxH1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.5  pyridoxal 5'-phosphate synthase
     SAVERM_3858 (pdxH1)
SSDB
Motif
Pfam: Putative_PNPOx PNP_phzG_C Pyrid_ox_like Pyridox_oxase_2
Other DBs
NCBI-ProteinID: BAC71570
NITE: SAV3858
UniProt: Q82GN9
Position
complement(4766266..4766940)
AA seq 224 aa
MTDRDPIHDPAAMREHYRLEGLDETELAAHPMDQFTRWFAQAAQAAAQGVVYEPNAMVVS
TADADGRPSSRTVLMKQYDEQGFVFYTNYDSRKARDLAANPYVSLLFPWHPMARQVVVTG
LARRTGRDETAAYFRTRPHGSQLGAWASAQSSVIFSRAELDAAYEQLGVRYPEGEQVPVP
PNWGGFRIAPQTVEFWQGRWNRLHDRLRYVAEPDGSWRVERLSP
NT seq 675 nt   +upstreamnt  +downstreamnt
gtgaccgaccgtgaccctatccacgaccccgcggcgatgcgtgagcactaccggctggag
ggactcgacgagaccgagctggccgcgcacccgatggatcagttcacccgctggttcgcg
caggccgcgcaggccgccgcacagggggtggtgtacgagccgaacgcgatggtcgtctcc
accgcggacgccgacggccggcccagttcgcgcacggtgctgatgaagcagtacgacgag
cagggcttcgtcttctacaccaactacgactcacgcaaggcgcgcgacctggccgccaac
ccgtacgtctcgctgctcttcccctggcatccgatggcccgccaggtggtcgtcacgggc
ctcgcgcgccggaccgggcgcgacgagacggccgcctacttccgcacccggccgcacggc
tcccagctcggcgcctgggccagcgcccagtcctcggtgatcttctcccgcgccgagctc
gacgcggcgtacgagcagttgggcgtccgctaccccgagggcgagcaggtcccggtcccg
ccgaactggggcggcttccgcatcgccccgcagacggtcgagttctggcagggccgctgg
aaccgcctccacgaccgcctgcgctacgtggccgagccggacggatcctggcgggtggag
cgactcagcccctga

DBGET integrated database retrieval system