KEGG   Streptomyces avermitilis: SAVERM_3828
Entry
SAVERM_3828       CDS       T00126                                 

Definition
(GenBank) putative pimeloyl-CoA synthetase
  KO
K24012  acetate---CoA ligase (ADP-forming) [EC:6.2.1.13]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00620  Pyruvate metabolism
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_3828
   00620 Pyruvate metabolism
    SAVERM_3828
   00640 Propanoate metabolism
    SAVERM_3828
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sma01004]
    SAVERM_3828
Enzymes [BR:sma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     SAVERM_3828
Lipid biosynthesis proteins [BR:sma01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SAVERM_3828
SSDB
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 ATP-grasp_2 Ligase_CoA_2 CoA_binding CPSase_L_D2 B12-binding AhpC-TSA
Other DBs
NCBI-ProteinID: BAC71540
NITE: SAV3828
UniProt: Q82GR9
Position
4730190..4732331
AA seq 713 aa
MHGRPAEADDLDVSGRPLYAGVPDLDRFFRPGSVAVIGASDTEGRPNTGITRQLLTWAER
VGARLHPVHPTRQSVFGIPCSPSVADLPEPVDLAVLLVADPLPVIEQLAGAKVKFAVAFA
SGFAETGEAGAAAQARLAAAVGRSGLRLLGPNTNLNAFEEFREDLDGPAIALITQSGHQG
RPVFTMQELGVRLSHWAPTGNEADLETADFISYFSERPEVGAIACYIEGLKDGRSFLLAA
DRAARRGVPVVAVKVGRTETGARTAASHTGKLTGADAVVDAAMRQYGVIRVDGLDELQDT
AALLARARAPQADGVVVYAISGGTGAHFADLASEAGLRLPVLSDAKQAELHEWIPEYLNV
TNPVDNGGHPVGDWRGRKIIDAILADPAVGVLICPITGPFPPMSDKLAQDLVDAAEATDK
LVCVVWGSPVGTEAAYRETLLGSSRVATFRTFANCITAVRAHLDHARFTASYRSPFDEAP
RTPSPSFRKAQALMRPGQQLSEHAAKQLLRAYGIRVPREQLVTSAAAAVRAASQVGYPVV
MKASGAQIAHKTELGLVKIGLTSASQVRDAYRELTDIARYEGISLDGVLVCQMVERGVEL
VVGVTHDQLFGPTVTVGLGGVLVEVLRDVAVRVPPFGEDQARAMLGELRGRALLDGVRGG
PPVDVDALVEVVIRVQRMALELGDDLAELDINPLMVLPRGQGAVALDALAVCR
NT seq 2142 nt   +upstreamnt  +downstreamnt
gtgcacggcaggcccgccgaggccgacgacctggatgtcagcggccgcccgctgtacgcc
ggcgtgcccgacctcgaccgcttcttccgccccgggtccgtcgccgtgatcggcgcctcg
gacaccgagggccggccgaacaccggcatcacccggcagctgctcacctgggccgaacgg
gtcggcgcccggctgcacccggtgcaccccacccgtcagtccgtcttcggcatcccctgc
tccccttccgtcgcggacctgcccgaaccggtcgatctggccgtgctgctggtcgccgac
ccccttcccgtgatcgagcaactcgccggtgccaaggtgaagttcgccgtcgccttcgcc
tccgggttcgccgagaccggcgaggcgggcgccgccgcacaggcccggctcgccgccgcc
gtgggacgctccgggctgcggctgctcggcccgaacaccaacctcaacgccttcgaggag
ttccgcgaggacctggacggaccggcgatcgcgctgatcacccaatccggacaccagggc
cgcccggtcttcacgatgcaggagctgggcgtccgactctcacactgggcgcccaccggc
aacgaggccgacctggagaccgccgacttcatctcctacttctccgaacggcccgaggtg
ggcgccatcgcctgctacatcgaggggctgaaggacggccgctcctttctgctcgccgcc
gaccgggccgcccggcgcggcgtgccggtggtcgcggtcaaggtcggccgcaccgagacc
ggcgcccggacggccgcctcccacaccggcaagctgaccggcgcggacgcggtggtggac
gcggcgatgcggcagtacggcgtgatccgcgtcgacgggctcgacgaactccaggacacc
gccgccctgttggcgcgggcccgcgcaccgcaggccgacggggtcgtcgtctatgcgatc
tcgggcggcacgggcgcgcacttcgcggacctggcgagcgaggccgggctgcgcctgccc
gtgctgtcggacgccaagcaggccgagctgcacgagtggataccggagtacctgaacgtc
accaaccccgtcgacaacggcgggcacccggtcggcgactggcgcggccggaagatcatc
gacgcgatcctcgccgacccggccgtcggggtgctgatctgccccatcaccgggcccttc
ccgccgatgagcgacaagctcgcgcaggatctggtggacgcggcggaggcgacggacaag
ctggtgtgcgtggtgtgggggtcgccggtcggcaccgaggccgcgtaccgcgagacgctc
ctcggctcgtcgcgggtcgccaccttccgtaccttcgcgaactgcatcaccgccgtccgc
gcccatctcgaccacgcgcggttcaccgcctcgtaccgctcgcccttcgacgaggcgccg
cgcaccccctcgccctccttccgcaaggcccaggccctgatgcgcccggggcagcagctg
agcgagcacgcggcgaaacagctgctgcgcgcctacggcatccgcgtgccgcgcgagcag
ttggtgaccagcgcggcggcggccgtgcgggcggcctcgcaggtcggctacccggtcgtc
atgaaggcgtccggcgcgcagatcgcccacaagaccgaactcggcctggtgaagatcgga
ctgacctccgccagccaggtcagggacgcctaccgcgagctgaccgacatcgcgcgctac
gaggggatctcgctcgacggggtgctggtgtgccagatggtggagcggggcgtcgagctg
gtcgtgggcgtcacgcacgaccagctcttcggaccgacggtgaccgtcgggctcggcggg
gtgctcgtcgaggtgctgcgggacgtcgccgtgcgcgtgccgccgttcggcgaggaccag
gcgcgggccatgctcggcgagctgcgcggacgggccctgctggacggggtgcgcggcggg
ccgcccgtggatgtggacgcgctggtggaggtcgtcatccgggtgcagcggatggccctc
gaactcggggacgacctcgcggagctggacatcaatccgctcatggtgctgccgcggggg
cagggagcggtggcactggacgcgctggcggtgtgccgctga

DBGET integrated database retrieval system