KEGG   Streptomyces avermitilis: SAVERM_3841
Entry
SAVERM_3841       CDS       T00126                                 

Gene name
fadD17
Definition
(GenBank) putative cyclohex-1-ene-1-carboxylate:CoA ligase
  KO
K04116  cyclohexanecarboxylate-CoA ligase [EC:6.2.1.-]
Organism
sma  Streptomyces avermitilis
Pathway
sma00362  Benzoate degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_3841 (fadD17)
Enzymes [BR:sma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     SAVERM_3841 (fadD17)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: BAC71553
NITE: SAV3841
UniProt: Q82GQ6
Position
4745600..4747099
AA seq 499 aa
MNDTAHALSTSGTLWELVVRRAGLTPDRTVLLQDDRSLSFGELRDRAERVAAGLYDMGVR
PGTVVAWQLPTRIETALLSFALARLGAVQSPVIPFYRDREVGFALRESKAEFFAVPGTWR
GFDHTAMARRLGAKGIFEAYDALPDGDPALLPAPPAQGTDVRWIYWTSGTTSDPKGVLHT
DRSLIAGGSCLAHALRLTADDVGSMAFPYAHIAGPDYTVMLLLYGFPAVMFEQFALPDAL
AGYRGHGVTVAGGSTAFYSIFLAEQRRQPDTPVVPTLRLLAGGGAPKPPEVYHRVVREMG
VQLTHGYGMTEVPMITMGSPDDTAENLATTEGRPPEGMEIRIVDGEVRLRGEAVCQGYLD
PRQTAEAFDEDGFLRTGDLGHLTGSGHLVLTGRLKDVIIRKGENISAKEIEDLLHRHPAV
GDVAVIGLPDAERGERVCAVVEQPPGAGALTLDAMTSYLRAEGLSVHKLPEQLEVVDALP
RNETLRKVLKYRLRERYAR
NT seq 1500 nt   +upstreamnt  +downstreamnt
gtgaacgacaccgcacacgcgctcagcacctccggcacgctctgggaactcgtcgtccgc
cgcgccggcctcacccccgaccggaccgtcctcctccaggacgaccggtccctgagcttc
ggcgaactccgcgaccgcgccgaacgggtggccgccggcctgtacgacatgggcgtacgc
cccggcacggtggtcgcctggcagctgcccacccgcatcgagaccgcgctgctgtccttc
gcgctggcccggctgggcgccgtccagtcgccggtcatccccttctaccgggaccgcgag
gtcggcttcgcgctgcgggagtcgaaggccgagttcttcgccgtgccgggcacctggcgg
gggttcgaccacacggcgatggcacggcggctgggcgcgaaggggatcttcgaggcctac
gacgccctgcccgacggcgaccccgcgctgctgcccgccccgcccgcccagggcaccgac
gtccgctggatctactggacctcggggacgacctccgaccccaagggcgtactgcacacg
gaccgttcactgatcgcgggcggatcctgtctcgcccacgccctgcgcctgacggcggac
gacgtgggctcgatggccttcccgtacgcgcacatcgccgggcccgactacacggtgatg
ctgctgctgtacggcttccccgcggtgatgttcgagcagttcgcgctgccggacgcgctg
gcgggctaccgggggcacggggtgacggtggcgggcgggtcgacggccttctactcgatc
ttcctggccgagcagcggcgacagccggacacgccggtcgtcccgacgctgcggctgctg
gcgggtggcggggcgcccaagccgcccgaggtctaccaccgtgtcgtacgcgagatgggc
gtgcagctcacccacggatacggcatgaccgaggtgccgatgatcacgatgggctccccg
gacgacacggccgagaacctggcgacgacggagggacggccgccggagggcatggagata
cggatcgtggacggagaggtacggctgcgcggggaggcggtgtgccagggctatctggat
ccgcggcagacggcggaggccttcgacgaggacgggttcctgcgtaccggcgacctgggc
catctcaccggcagcgggcatctggtgctgaccggccgcctcaaggacgtcatcatccgc
aagggcgagaacatctcggcgaaggagatcgaggatctgctgcaccggcatccggccgtc
ggggacgtcgccgtgatcggtctgccggacgcggagcgcggggagcgggtctgcgcggtg
gtcgaacagccgccgggagcgggggcgttgacgctggacgcgatgacctcgtatctgcgg
gcggaagggctgtccgtccacaagctgccggagcagctggaggtggtggacgcccttccg
cgcaacgagaccctgcggaaggtgctcaagtaccggctgagggagcgctatgcgcggtga

DBGET integrated database retrieval system