KEGG   Streptomyces avermitilis: SAVERM_3846Help
Entry
SAVERM_3846       CDS       T00126                                 

Gene name
purU
Definition
(GenBank) putative formyltetrahydrofolate deformylase
  KO
K01433  formyltetrahydrofolate deformylase [EC:3.5.1.10]
Organism
sma  Streptomyces avermitilis
Pathway
sma00630  Glyoxylate and dicarboxylate metabolism
sma00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_3846 (purU)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_3846 (purU)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.10  formyltetrahydrofolate deformylase
     SAVERM_3846 (purU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N ACT ACT_6 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: BAC71558
NITE: SAV3846
UniProt: Q82GQ1
Position
complement(4750759..4751640)
Genome map
AA seq 293 aa AA seqDB search
MNEQSVRAAAPAEQYVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRV
HFSAEAPVTVEKLRASFTAIGDAFHMDWQIHRAEDRMRVVLMVSKFGHCLNDLLFRARTG
ALPVEIAAVVSNHTDFAELVASYDIPFHHIPVTRDNKAEAEAQLLELVRSENIELVVLAR
YMQVLSDDLCKQLSGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGP
IIEQEVERVGHDVTPDQLVAIGRDVECQALARAVKWHAERRILLNGRRTVVFA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcagtccgtccgcgccgccgcgcccgctgagcagtatgtcctcaccctctcc
tgcccggacaagcagggaatcgtgcacgccgtgtcgagctatctcttcatgaccggctgc
aacatcgaggacagtcagcagttcggcgaccacgacaccggtctgttcttcatgcgggtc
cacttctcggcggaggcgccggtgacggtggagaagctgcgcgcgagcttcacggcgatc
ggcgacgccttccacatggactggcagatccaccgggccgaggaccggatgcgggtcgtc
ctcatggtcagcaagttcggccactgtctgaacgacctgctcttccgcgcccggaccggc
gcgctgccggtcgagatcgcggccgtggtgtccaatcacacggacttcgcggagcttgtg
gcgtcgtacgacatccccttccaccacattccggtgacgagggacaacaaggcggaggcc
gaggcgcagctgctggagctggtccgcagcgagaacatcgagctggtcgtcctcgcccgc
tatatgcaggtcctctcggacgacctgtgcaagcagctcagcggccggatcatcaacatc
caccactccttcctgccgagcttcaagggtgcgaagccgtaccaccaggcgcacgcccgc
ggtgtgaagctcatcggtgccaccgcgcactacgtgaccgcggacctcgacgagggcccg
atcatcgagcaggaggtcgagcgggtgggccacgacgtgacgccggaccagctggtcgcg
atcgggcgtgacgtggagtgccaggcgctggcgcgtgcggtgaagtggcacgcggagcgc
cgcatcctgctgaacggccgccgcacggtcgtcttcgcgtag

DBGET integrated database retrieval system