KEGG   Streptomyces avermitilis: SAVERM_3883
Entry
SAVERM_3883       CDS       T00126                                 

Gene name
serC
Definition
(GenBank) putative phosphoserine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00270  Cysteine and methionine metabolism
sma00680  Methane metabolism
sma00750  Vitamin B6 metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_3883 (serC)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_3883 (serC)
   00270 Cysteine and methionine metabolism
    SAVERM_3883 (serC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAVERM_3883 (serC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_3883 (serC)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     SAVERM_3883 (serC)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class V
   SAVERM_3883 (serC)
SSDB
Motif
Pfam: Aminotran_5
Other DBs
NCBI-ProteinID: BAC71595
NITE: SAV3883
UniProt: Q82GL4
Position
4797602..4798720
AA seq 372 aa
MAEIQIPSDIKPADGRFGAGPSKVRTEALDALAATGSSLLGTSHRQAPVKNLVGKVREGV
SELFSLPEGYEVILGNGGSTAFWDVATHGLIDNKSQHLSFGEFSLKFAKAAKLAPWLAEP
TVISSDPGTHPEPAAEAGVDVYAFTHNETSTGVAAPIKRVAGADEGSLVLVDATSGAGGL
PVDITETDVYYFAPQKSFAADGGLWLAVFSPAAIERAERIHASGRHVPEFFSIPTAIDNS
RKNQTYNTPALATLFLLNEQLEWINGQGGLDWAVGRTAASSSALYGWAEDVKYATPFVTD
PAKRSQVIGTIDFADEVDAAAVAKALRANGIVDTEPYRKLGRNQLRVAMFPAIDPADVEA
LTKCIDYVIEKL
NT seq 1119 nt   +upstreamnt  +downstreamnt
gtggctgagatccagattccttccgacatcaagcccgctgacggacgtttcggcgcgggt
ccctccaaggtgcggacagaggcgctggacgccctggccgccacgggcagctccctgctc
ggcacctcccaccgacaggcgccggtcaagaacctggtcggcaaggtccgcgagggcgtc
agcgagctgttctcgctgcccgagggctacgaggtgatcctcggcaacggcggctccaca
gcgttctgggacgtcgcgacccacgggctgatcgacaacaagtcccagcacctcagcttc
ggcgagttctcgttgaagttcgcgaaggccgcgaagctcgccccctggctcgccgagccc
acggtcatctcctccgacccgggcacccaccccgagccggccgccgaggcgggcgtggac
gtctacgccttcacgcacaacgagacctccaccggtgtcgccgccccgatcaagcgcgtc
gcgggcgccgacgagggctccctggtcctcgtggacgccacctccggcgcgggcggcctg
ccggtcgacatcaccgagaccgacgtctactacttcgccccgcagaagtccttcgccgcc
gacggcggcctgtggctcgcggtgttctccccggccgcgatcgagcgcgccgagcgtatc
cacgcctccggccgccacgtcccggagttcttctcgatcccgacggcgatcgacaactcc
cgcaagaaccagacgtacaacaccccggccctcgccaccctcttcctcctcaacgagcag
ctggagtggatcaacggccagggcggcctggactgggcggtgggccgcacggcggcctcg
tcgagcgcgctgtacggctgggccgaggacgtgaagtacgcgaccccgttcgtcaccgac
ccggccaagcgctcgcaggtcatcggcacgatcgacttcgcggacgaggtcgacgccgcc
gccgtcgccaaggccctgcgcgccaacggcatcgtcgacaccgagccctaccgcaagctc
ggccgcaaccagctccgcgtcgcgatgttcccggcgatcgacccggcggacgtcgaggcg
ctgacgaagtgcatcgactacgtgatcgagaagctgtaa

DBGET integrated database retrieval system