KEGG   Streptomyces avermitilis: SAVERM_3979
Entry
SAVERM_3979       CDS       T00126                                 

Gene name
gpmA1
Definition
(GenBank) putative 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00260  Glycine, serine and threonine metabolism
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00002  Glycolysis, core module involving three-carbon compounds
sma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_3979 (gpmA1)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_3979 (gpmA1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_3979 (gpmA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sma04131]
    SAVERM_3979 (gpmA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_3979 (gpmA1)
Enzymes [BR:sma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAVERM_3979 (gpmA1)
Membrane trafficking [BR:sma04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAVERM_3979 (gpmA1)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAVERM_3979 (gpmA1)
  Exosomal proteins of melanoma cells
   SAVERM_3979 (gpmA1)
SSDB
Motif
Pfam: His_Phos_1 DUF4015
Other DBs
NCBI-ProteinID: BAC71691
NITE: SAV3979
UniProt: Q82GB8
Position
4905162..4905923
AA seq 253 aa
MADAPYKLILLRHGESEWNAKNLFTGWVDVNLNEKGEKEAVRGGELLKDAGLLPDVVHTS
LQKRAIRTAQLALESADRHWIPVHRSWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRRS
YDTPPPPLADGSEFSQSDDPRYASIPPELRPKTECLKDVVNRMLPYWYDGIVPDLLTGRT
VLVAAHGNSLRALVKHLDGISDEDIAGLNIPTGIPLSYELDTDFKPLNPGGTYLDPDAAA
AAIEAVKNQGKKK
NT seq 762 nt   +upstreamnt  +downstreamnt
atggccgacgcaccgtacaagctgatcctcctccgccacggcgagagcgaatggaacgcg
aagaacctgttcaccggctgggtggacgtcaacctcaacgagaagggcgagaaggaggct
gtccgcggcggtgagctgctgaaggacgccggcctgctgcccgacgtggtccacacgtcg
ctccagaagcgcgcgatccgcaccgcccagctcgcgctggagtccgcggaccgccactgg
atcccggtccaccgctcgtggcgcctgaacgagcgtcactacggcgccctccagggcaag
gacaaggcgcagacgctcgccgagttcggcgaggagcagttcatgctctggcgccgctcg
tacgacaccccgcccccgcccctcgcggacggctccgagttctcccagtcggacgacccg
cgctacgcctccatccccccggagctgcgccccaagacggagtgcctcaaggacgtcgtc
aaccggatgctcccgtactggtacgacggcatcgtcccggacctgctgaccggccgcacg
gtcctggtcgcggcccacggcaacagcctccgcgccctggtcaagcacctcgacggcatc
tccgacgaggacatcgcgggcctgaacatcccgacgggcatcccgctgtcctacgaactc
gacacggacttcaagccgctcaacccgggcggcacctacctcgacccggacgcggcggcg
gcggcgatcgaggcggtcaagaaccagggcaagaagaagtaa

DBGET integrated database retrieval system