KEGG   Streptomyces avermitilis: SAVERM_4132
Entry
SAVERM_4132       CDS       T00126                                 

Gene name
vdh
Definition
(GenBank) putative valine dehydrogenase (NADP+)
  KO
K00271  valine dehydrogenase (NAD+) [EC:1.4.1.23]
Organism
sma  Streptomyces avermitilis
Pathway
sma00280  Valine, leucine and isoleucine degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_4132 (vdh)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.23  valine dehydrogenase (NAD+)
     SAVERM_4132 (vdh)
SSDB
Motif
Pfam: ELFV_dehydrog_N ELFV_dehydrog NAD_binding_2 NAD_binding_7 2-Hacid_dh_C TrkA_N Epimerase F420_oxidored Shikimate_DH Gp_dh_N 3HCDH_N NAD_binding_10 GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: BAC71844
NITE: SAV4132
UniProt: Q82FX0
Position
5070973..5072058
AA seq 361 aa
MTDVSDGVLHTLFRSDQGGHEQVVLCQDRATGLKAVIAIHSTALGPALGGTRFYPYASEE
EAVADALNLARGMSYKNAMAGLDHGGGKAVIIGDPERIKTEELLLAYGRFVASLGGRYVT
ACDVGTYVADMDVVARECRWTTGRSPENGGAGDSSVLTAFGVFQGMRASAQHLWGDPTLR
GRKVGIAGVGKVGRHLVRHLLDDGAEVVITDVRTDSVQRILDQHPTGVTAVADTDALIRV
DGLDIYAPCALGGALNDDSVTVLTAKIVCGAANNQLAHTGVEKDLADRGILYAPDYVVNA
GGVIQVADELHGFDFDRCKAKAAKIFDTTLAIFARAKEDGIPPAAAADRIAEQRMAEARR
G
NT seq 1086 nt   +upstreamnt  +downstreamnt
gtgaccgatgtatccgacggcgtcctgcacaccctgttccgctcggaccagggggggcat
gagcaagtcgtgctctgccaggaccgggccactggtctcaaggccgtcatcgccatccac
tccaccgccctgggccccgccctcggcggtacgcgcttctacccgtacgcgagcgaggag
gaggccgtcgccgacgcgctgaacctcgcgcgcgggatgtcgtacaagaacgccatggcc
ggcctcgaccacggcggcggcaaggccgtcatcatcggtgaccccgagcggatcaagacc
gaggagctgctgctggcctacggccggttcgtggcctcgctcggcgggcggtacgtcacc
gcgtgcgacgtcggtacgtacgtcgccgacatggacgtcgtggcgcgcgagtgccgctgg
acgaccgggcgctccccggagaacggcggcgcgggcgactcctccgtgctgaccgccttc
ggtgtcttccagggcatgcgggcctccgcccagcacctgtggggcgacccgacgctgcgc
ggccgcaaggtgggcatcgcgggcgtcggcaaggtcggccgccacctggtgcggcacctg
ctggacgacggcgcggaggtcgtgatcacggacgtgcggaccgactccgtacagcggatc
ctcgaccagcacccgacgggcgtcacggccgtcgcggacaccgacgcgctgatccgggtg
gacgggctcgacatctacgccccgtgcgcgctcggcggggccctgaacgacgactccgtc
acggtgctcaccgcgaagatcgtgtgcggcgcggccaacaaccagctcgcccacacgggc
gtcgagaaggacctcgccgaccgcgggatcctctacgcgccggactacgtggtgaacgcg
ggcggggtcatccaggtcgccgacgagctgcacggcttcgacttcgaccggtgcaaggcg
aaggccgcgaagatcttcgacaccacgctggccatattcgcacgtgcgaaggaagacggc
attccgccggccgccgcggccgaccggattgccgagcagcgcatggcggaggcccgccgg
ggctga

DBGET integrated database retrieval system