KEGG   Streptomyces avermitilis: SAVERM_4150Help
Entry
SAVERM_4150       CDS       T00126                                 

Gene name
dnaZX
Definition
(GenBank) putative DNA polymerase III gamma and tau subunit
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_4150 (dnaZX)
   03430 Mismatch repair
    SAVERM_4150 (dnaZX)
   03440 Homologous recombination
    SAVERM_4150 (dnaZX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_4150 (dnaZX)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_4150 (dnaZX)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_4150 (dnaZX)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_4150 (dnaZX)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_4150 (dnaZX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_gamma3 AAA RuvB_N Rad17 AAA_30 AAA_22 AAA_16 AAA_14 AAA_5 zf-CXXC Mg_chelatase T2SSE TsaE AAA_19 AAA_18
Motif
Other DBs
NCBI-ProteinID: BAC71862
NITE: SAV4150
UniProt: Q82FV2
Position
complement(5092430..5094970)
Genome map
AA seq 846 aa AA seqDB search
MSSLALYRRYRPESFAEVIGQEHVTDPLQQALRNNRVNHAYLFSGPRGCGKTTSARILAR
CLNCEQGPTPTPCGACQSCQDLARNGPGSIDVIEIDAASHGGVDDARDLREKAFFGPAGS
RYKIYIIDEAHMVTSAGFNALLKVVEEPPEHLKFIFATTEPEKVIGTIRSRTHHYPFRLV
PPGTLREYLGDVCGRENIPVADGVLPLVVRAGGGSVRDSMSVMDQLLAGAGADGVTYAMA
TSLLGFTDGSLLDSVVEAFASGDGAAAFEVVDRIIEGGNDPRRFVADLLERLRDLVILAA
VPDAGEKGLIDAPADVVERMQAQAGVFGAAELSRAADLVNEGLTEMRGATSPRLQLELIC
ARVLLPAAYGDDRSLMARLDRLERGVNFSGGGAGPAMGYVPGPGAHGGASVPQMSQPAQT
PQVPQMPQMSQGSYAQQAPQVPPGGGVDAARAAVRGGPGGAGGPAAGQGVPGAEAAYGDV
DAGVAGSGAASAPVQEAPAEAAPPASQPTAEQPQPQPPAQPQPHTQPQAPAAAPAPAPGA
WPTASAAGSGRRPGGWPTATPAGGGQPQTPAAAASAAPPASGPAPASAPAPSAPAPAPAA
AYAPAAGGPDPRMLWPNILEAVKNRRRFTWILLSQNAQVTGFDGTTLQIGFVNAGARDNF
ASSGSEDVLRQALAEQFNVQWKIEAVVDPSGGSAQAAGGGSGPRVRRRRCRVQRGRRLRL
RRRVRRSSGRPAPRAAAVRPTGAGPRRVGGSGPVRQTDCARPGIHTTARSATAHRPRGRH
GGGRRPRPRRVRPLGPRTDRPGARGDGDGGVLPRVRAPAAARRGGVWLAASRMSHSPRPF
LARPFD
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtctctcgcgctgtaccgccgctatcgcccggagtcgttcgccgaggtcatcggg
caggagcatgtcaccgacccgctgcagcaggcgctgcggaacaaccgggtcaatcacgcg
tacctgttcagcggtccgcgcggatgcgggaagaccaccagcgcacgcatcctggccagg
tgcctgaactgcgagcaggggcccacgcccaccccctgcggcgcatgccagtcctgccag
gacctcgcgaggaacgggccgggatcgatcgacgtcatcgagatcgacgccgcttcgcac
ggtggtgtggacgacgcgcgtgacctgcgggaaaaggccttcttcggaccggcgggcagc
cggtacaagatctacatcatcgacgaggcccacatggtcacgtcggccggtttcaacgcg
ctcctcaaggtcgtcgaggagccgccggagcatctgaagttcatcttcgcgaccaccgag
cccgagaaggtcatcggaaccatccgttcgcggacccatcactatcccttccggctcgtg
ccgcccgggacccttcgggagtacctcggcgacgtgtgcgggcgggagaacatccccgtc
gcggacggggtgctgccgctcgtggtgcgcgccggcggcggttccgtacgtgactccatg
tccgtcatggaccagctgctcgcgggagcgggcgccgacggtgtgacgtacgccatggcc
acctcgctcctcgggttcacggacgggtcgctgctcgactcggtggtcgaggcgttcgcg
tcgggcgacggagccgcggccttcgaggtcgtggaccggatcatcgaggggggcaacgat
ccgcggcggttcgtcgccgacctgctggagcggctgcgggacctggtgatcctggccgcc
gtgcccgacgcgggcgagaaggggctcatcgacgctcccgccgatgtcgtggagcggatg
caggcccaggccggggtcttcggcgccgccgaactcagccgggccgccgacctcgtcaat
gaggggctgacggagatgcggggcgccacttcgccccggctccagctcgaactcatctgc
gcgcgcgtgctgctgccggcggcgtacggcgacgaccgttcgctcatggcccggctggac
cggctggagcgcggcgtcaacttctccggcgggggtgcggggccggccatggggtacgtg
cccgggcccggcgcgcacggcggggcttcggtgcctcagatgtctcagccggcccagacg
cctcaggtgccgcagatgcctcagatgtcccaggggtcttacgcccagcaggccccccag
gtgccgccggggggcggagtcgatgcggctcgggccgcggtgcggggcgggcccggtggg
gcgggcggtcctgccgccgggcagggcgtaccgggtgcggaggccgcgtacggggatgtc
gacgccggggtggccggctcgggcgcggcttcggcgcccgtccaggaggcgcccgcggag
gctgcgccgcccgcttcccagccgaccgctgagcagccccagccccagccaccggcacag
ccacaacctcatacccagccgcaggctcccgccgccgcgcccgcgcccgcaccgggagcc
tggcccaccgcgagcgccgcgggcagcggccggcgtccgggtggctggccgacggccacg
cccgcgggcgggggacagccgcagactccggccgccgctgcctctgccgctccccccgct
tccggccctgccccggcttccgctccggcgccctcagccccggcgcccgctcccgccgcg
gcctacgccccggctgccggtgggcccgacccccgcatgctctggccgaacatcctggag
gcggtgaagaaccggcgccgcttcacctggatcctgctcagccagaacgcgcaggtcacg
ggtttcgacggcacgacgctccagatcggcttcgtcaacgcgggcgcgcgggacaacttc
gcgagcagcggcagcgaggacgtactgcggcaggcgctggccgagcagttcaacgtgcag
tggaagatcgaggcggtcgtcgacccgtcgggcggttcggcccaagcggcgggcgggggc
tccggcccccgggttcggcggcggcggtgccgggttcaacgcgggcggcggctccggctt
cggcggcgggtacggcggagctccggccgccccgcgccccgcgccgcagcagtccgcccc
accggcgccgggccccgccgcgtcggtggctccggccccgtccgccagacagactgcgcc
cgccccggcatccacaccaccgcccgctccgccacggcacatcgcccccgaggacgacat
gggggaggacgacgaccccgacctcgacgagtccgccctctcgggccacgaactgatcgt
ccgggagctcggggcgacggtgatggaggagttctcccacgagtaagggcgccggcagcg
gcccggcgaggaggggtgtggctcgcggcgtcgcggatgtcccacagcccccgcccgttc
ctcgcccgacccttcgactag

DBGET integrated database retrieval system