KEGG   Streptomyces avermitilis: SAVERM_4288Help
Entry
SAVERM_4288       CDS       T00126                                 

Gene name
ssb1
Definition
(GenBank) putative single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_4288 (ssb1)
   03430 Mismatch repair
    SAVERM_4288 (ssb1)
   03440 Homologous recombination
    SAVERM_4288 (ssb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_4288 (ssb1)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_4288 (ssb1)
   03029 Mitochondrial biogenesis [BR:sma03029]
    SAVERM_4288 (ssb1)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SAVERM_4288 (ssb1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     SAVERM_4288 (ssb1)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    SAVERM_4288 (ssb1)
Mitochondrial biogenesis [BR:sma03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    SAVERM_4288 (ssb1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB tRNA_anti-codon tRNA_anti_2 DUF4131 Ribosomal_S3_C NNMT_PNMT_TEMT
Motif
Other DBs
NCBI-ProteinID: BAC72000
NITE: SAV4288
UniProt: Q82FG5
Position
complement(5254217..5254825)
Genome map
AA seq 202 aa AA seqDB search
MAGETVITVVGNLVDDPELRFTPSGAAVAKFRVASTPRTFDRQTNEWKDGESLFLTCSVW
RQAAENVAESLQRGMRVIVQGRLKQRSYEDREGVKRTVYELDVEEVGASLKNATAKVTKT
TGRSGQGGQGGYGGGGGGQQGGGWGGGSGGAPQGGGAPADDPWATGTPAGGNQGGGGGGG
WGGSSGGSSGGSGGGYSDEPPF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgagaccgtcatcacggtcgtcggcaatcttgtcgacgaccccgagctgcgc
ttcaccccttccggtgcggcggtcgcgaagttccgtgtcgcgtccaccccccgcaccttc
gaccgtcagaccaatgagtggaaggacggcgagagcctgttcctgacctgctcggtctgg
cgtcaggcggcggagaacgtcgccgagtcgctccagcgaggcatgcgcgtcatcgtgcag
ggccggctgaagcagcggtcctacgaggaccgtgagggcgtcaagcgcacggtctacgag
ctggacgtcgaggaagtcggcgccagcctgaagaacgccacggccaaggtcaccaagacc
acgggccggagcggccagggcggccagggcggttacggcggcggtggcggcggccagcag
ggcggcggctggggcggtggctccggcggcgctccgcagggcggcggcgctccggccgac
gacccctgggcgaccggcactcccgccggtggcaaccagggcggcggcggtggcggcggc
tggggcggaagctccggcggcagcagcggcggcagcggcggcggctactcggacgaaccc
cccttctag

KEGG   Streptomyces avermitilis: SAVERM_5365Help
Entry
SAVERM_5365       CDS       T00126                                 

Gene name
ssb2
Definition
(GenBank) putative single-strand DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_5365 (ssb2)
   03430 Mismatch repair
    SAVERM_5365 (ssb2)
   03440 Homologous recombination
    SAVERM_5365 (ssb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_5365 (ssb2)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_5365 (ssb2)
   03029 Mitochondrial biogenesis [BR:sma03029]
    SAVERM_5365 (ssb2)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SAVERM_5365 (ssb2)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     SAVERM_5365 (ssb2)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    SAVERM_5365 (ssb2)
Mitochondrial biogenesis [BR:sma03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    SAVERM_5365 (ssb2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB Trypan_PARP
Motif
Other DBs
NCBI-ProteinID: BAC73077
NITE: SAV5365
UniProt: Q82CI4
Position
6505871..6506347
Genome map
AA seq 158 aa AA seqDB search
MNETIVCVVGNVATRPVYRELASGASARFRLAVTSRYWDREKSEWKDGHTNFFTVWANRA
LATNVGASLSVGDPVVVQGRLKVRTEAREGQNWTSADIDALAVGHDLSRGTSAFRRPSAK
DGEAGVSPAARPEPNWETEPGSQPSVEHQPQPEPAGVT
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagacgatcgtgtgcgtggtggggaacgtcgccacgcggccggtgtaccgggag
ctggcgtcgggcgcatcggcgcggttccggctggcggtgacgtcgcggtactgggaccgc
gagaagagcgagtggaaggacgggcacaccaacttcttcacggtgtgggcgaatcgagcc
ctggccaccaacgtgggggcgtctttgtccgtgggggatccggtcgtcgtgcagggcagg
ctgaaggtgcgcaccgaggcgcgcgaggggcagaactggacctcggcggacatcgacgcg
ctggcggtcggccacgatctctcgcgcggcacgtcggcatttcgccgtccctcggccaag
gacggggaagcgggagtgagccccgccgcgcggccggagcccaactgggagacagagcca
ggaagtcagccctcggtggagcaccaaccccagccggagcccgctggagtgacgtga

DBGET integrated database retrieval system