KEGG   Streptomyces avermitilis: SAVERM_4299Help
Entry
SAVERM_4299       CDS       T00126                                 

Gene name
pcnA
Definition
(GenBank) putative RNA nucleotidyltransferase
  KO
K00970  poly(A) polymerase [EC:2.7.7.19]
Organism
sma  Streptomyces avermitilis
Pathway
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_4299 (pcnA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sma03019]
    SAVERM_4299 (pcnA)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     SAVERM_4299 (pcnA)
Messenger RNA biogenesis [BR:sma03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     SAVERM_4299 (pcnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PolyA_pol PolyA_pol_RNAbd HD tRNA_NucTran2_2
Motif
Other DBs
NCBI-ProteinID: BAC72011
NITE: SAV4299
UniProt: Q82FF4
Position
complement(5266959..5268401)
Genome map
AA seq 480 aa AA seqDB search
MPNANEDNPSALSQVQRRAVSELLRVSPVADELARRFQEAGFSLALVGGSVRDALLGRLG
NDLDFTTDARPEDVLKIVRPWADAMWEVGIAFGTVGAQKEGYQIEVTTYRSEAYDRTSRK
PEVSYGDSIEEDLVRRDFTVNAMAVALPEKEFIDPHGGLDDLAARILRTPGTPEESFSDD
PLRMMRAARFAAQLDFEVAPDVVTAMTEMAGRIDIVSAERVRDELNKLVLSAHPRKGLTL
LVDTGLADHVLPELPALRLERDEHHRHKDVYDHSLIVLEQAIALEENGPDLTLRLAALLH
DIGKPRTRRFEKDGRVSFHHHEVVGAKMTKKRMTALKYSNDLVKDVSRLVELHLRFHGYG
TGEWTDSAVRRYVRDAGPLLDRLHKLTRSDCTTRNKRRAAALSRAYDGLEERIAQLQEQE
ELDAIRPDLDGNQIMEVLGVGPGPVIGQAYKFLLELRLENGPMEYDAAVAALKEWWAEQN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaacgccaacgaagacaaccccagtgccctgagtcaggtgcagcgccgcgcggtg
agtgaactgctgcgggtgtcccctgtcgccgacgagctcgcccgccgcttccaggaggcc
gggttctcgcttgccctggtcggcggctcggtgcgggatgcccttctcggccggctcggc
aacgatctggacttcacgaccgacgcccgccccgaggacgtactcaagatcgtccgtcca
tgggcggacgccatgtgggaggtcgggatcgcgttcggcacggtcggggcccagaaagag
ggctaccagatcgaggtgaccacctaccggtcggaggcgtacgaccgcacctcacgcaag
cccgaggtgtcgtacggcgactccatcgaggaggatctcgtccggcgtgacttcacggtc
aacgcgatggcggtggcactgcccgagaaggagttcatcgacccgcacggtgggctcgac
gacctggccgcgcgcattctgcgcaccccgggcaccccggaggagtcgttctcggacgac
ccgctgcggatgatgcgggcggcgcgcttcgccgcgcagctcgacttcgaggtggccccc
gatgtcgtcacggcgatgacggagatggccggccgtatcgacatcgtctccgcggagcgg
gtacgggacgagctgaacaagctggtcctgtccgcgcacccgcgtaaggggctgacactg
ctggtcgacaccggtctcgccgatcacgtcctgccggagctgcccgcgctgcggctggaa
cgtgacgagcatcaccggcacaaggacgtctacgaccactcgttgatcgtgttggagcag
gcgatcgcgctggaagagaacggccccgacctgacgctgaggctcgccgcgctcttgcac
gacatcggcaagccgaggacgcgccgcttcgagaaggacggccgggtctccttccatcac
cacgaggtggtgggcgccaagatgacgaagaagcggatgacggcgctcaagtactccaac
gacctggtgaaggacgtctcgcggctggtcgaactccacctccgcttccacggctacggc
acgggcgagtggacggactccgccgtgcgccgttatgtccgtgacgcgggcccgctcctc
gaccgtcttcacaaactgacccgctccgactgcacgacccgcaacaagcgcagggccgcc
gcgctgtcccgcgcgtacgacggtctggaggagcgcatcgcccagctccaggaacaagag
gaactggacgcgatccgtcccgacctcgacggcaaccagatcatggaggttctgggcgtc
gggcccggcccggtcatcggtcaggcgtacaagttcctgctggaacttcgtctggagaac
gggccgatggagtacgacgcggcggtggccgcgctcaaggagtggtgggccgagcagaac
tga

DBGET integrated database retrieval system