KEGG   Streptomyces avermitilis: SAVERM_4319Help
Entry
SAVERM_4319       CDS       T00126                                 

Gene name
recF
Definition
(GenBank) putative DNA recombination and repair protein
  KO
K03629  DNA replication and repair protein RecF
Organism
sma  Streptomyces avermitilis
Pathway
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SAVERM_4319 (recF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_4319 (recF)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     SAVERM_4319 (recF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_23 AAA_15 AAA_21 AAA_29 AAA_33 SbcCD_C ABC_tran
Motif
Other DBs
NCBI-ProteinID: BAC72031
NITE: SAV4319
UniProt: Q82FD5
Position
5291312..5292433
Genome map
AA seq 373 aa AA seqDB search
MHVTHLSLADFRSYARVEVPLDPGVTAFVGPNGQGKTNLVEAVGYLATLGSHRVSSDAPL
VRMGAERAIIRAQVRQDERRQLVELELNPGKANRARINRSSQVRPRDVLGIVRTVLFAPE
DLALIKGDPGERRRFLDELITARSPRMAGVRSDYERVLKQRNTLLKTAALARRHGGRSMD
LSTLDVWDQHLARAGAELLAQRLDLIAALQPLADKAYEQLAPGGGPIALEYKPSAPGEAH
TRDALYEQLMAALAEARKQEIERGVTLVGPQRDELLLKLGQLPAKGYASHGESWSYALAL
RLASYDLLRAEGNEPVLVLDDVFAELDTRRRERLAELVAPGEQVLVTAAVDDDVPGVLAG
TRYTVSEGTVERV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcacgcatctgtcgctggccgacttccgctcgtacgcccgggtcgaggtcccg
ctcgacccgggcgtcaccgccttcgtgggacccaacgggcagggcaagacgaacctcgtc
gaggcggtcggctatctcgccaccctcggcagccaccgggtctcgtccgacgcgcccctg
gtccgcatgggcgccgaacgcgcgatcatccgggcccaggtccggcaggacgagcgccgg
cagctcgtcgagctggagctgaacccgggcaaggccaatcgcgctcgcatcaacaggtcc
tcgcaggtcagaccccgtgacgtgctgggcatcgtacgtactgtcctgttcgccccggag
gacctcgcgctgatcaagggcgaccccggggagcggcgccgtttcctcgacgagctgatc
accgcccgctccccgcgcatggccggcgtccgttccgactacgagcgggtcctcaagcag
cgcaacaccctcctcaagacggccgcgctggcccgccggcacggcggccgttccatggat
ctgtccaccctcgacgtgtgggaccagcacctcgcccgcgccggcgccgaactgctcgcc
cagcgcctggacctgatcgccgcgctccagccgctcgccgacaaggcgtacgaacagctg
gcacccggcggcggcccgatcgccctggagtacaagccgtccgccccgggtgaggcccac
acgcgggacgccctctacgagcagttgatggccgcgctcgccgaggcccgcaagcaggag
atcgagaggggcgtcaccctggtgggtccccaacgtgacgaacttctcctcaagctcggc
cagcttccggcaaagggatacgcgtcacacggcgagtcctggtcgtacgcgctggcgctg
cgcctggcgtcgtacgacctcctgcgcgccgaggggaacgagccggtgctcgtcctcgac
gacgtcttcgccgagctggacacccgcagaagagagcgcctcgcggaactcgtcgccccg
ggagagcaggtgctggtgaccgccgcggtcgacgacgacgtgccgggggtcctggcggga
acgcggtacaccgtgtccgaggggaccgtggagcgcgtatga

DBGET integrated database retrieval system