KEGG   Streptomyces avermitilis: SAVERM_4362
Entry
SAVERM_4362       CDS       T00126                                 

Gene name
bkdA
Definition
(GenBank) putative 3-methyl-2-oxobutanoate dehydrogenase (lipoamide) (EC 1.2.4.4) E1-alpha chain
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_4362 (bkdA)
   00020 Citrate cycle (TCA cycle)
    SAVERM_4362 (bkdA)
   00620 Pyruvate metabolism
    SAVERM_4362 (bkdA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SAVERM_4362 (bkdA)
SSDB
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C
Other DBs
NCBI-ProteinID: BAC72074
NITE: SAV4362
UniProt: Q79Z51
Position
5339763..5340908
AA seq 381 aa
MTVMEQRGAYRPTPPPAWQPRTDPAPLLPDALPHRVLGTEAAAEADPLLLRRLYAELVRG
RRYNTQATALTKQGRLAVYPSSTGQEACEVAAALVLEERDWLFPSYRDTLAAVARGLDPV
QALTLLRGDWHTGYDPREHRIAPLCTPLATQLPHAVGLAHAARLKGDDVVALALVGDGGT
SEGDFHEALNFAAVWQAPVVFLVQNNGFAISVPLAKQTAAPSLAHKAVGYGMPGRLVDGN
DAAAVHEVLSDAVAHARAGGGPTLVEAVTYRIDAHTNADDATRYRGDSEVEAWRAHDPIA
LLEHELTERGLLDEDGIRAAREDAEAMAADLRARMNQDPALDPMDLFAHVYAEPTPQLRE
QEAQLRAELAAEADGPQGVGR
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgacggtcatggagcagcggggcgcttaccggcccacaccgccgcccgcctggcagccc
cgcaccgaccccgcgccactgctgcccgacgcgctgccccaccgcgtcctgggcaccgag
gcggccgcggaggccgacccgctactgctgcgccgcctgtacgcggagctggtgcgcggc
cgccgctacaacacgcaggccacggctctcaccaagcagggccggctcgccgtctacccg
tcgagcacgggccaggaggcctgcgaggtcgccgccgcgctcgtgctggaggagcgcgac
tggctcttccccagctaccgggacaccctcgccgccgtcgcccgcggcctcgatcccgtc
caggcgctcaccctcctgcgcggcgactggcacaccgggtacgacccccgtgagcaccgc
atcgcgcccctgtgcacccctctcgcgacccagctcccgcacgccgtcggcctcgcgcac
gccgcccgcctcaagggcgacgacgtggtcgcgctcgccctggtcggcgacggcggcacc
agcgagggcgacttccacgaggcactgaacttcgccgccgtctggcaggcgccggtcgtc
ttcctcgtgcagaacaacggcttcgccatctccgtcccgctcgccaagcagaccgccgcc
ccgtcgctggcccacaaggccgtcggctacgggatgccgggccgcctggtcgacggcaac
gacgcggcggccgtgcacgaggtcctcagcgacgccgtggcccacgcgcgcgcgggaggg
gggccgacgctcgtggaggcggtgacctaccgcatcgacgcccacaccaacgccgacgac
gcgacgcgctaccggggggactccgaggtggaggcctggcgcgcgcacgacccgatcgcg
ctcctggagcacgagttgaccgaacgcgggctgctcgacgaggacggcatccgggccgcc
cgcgaggacgccgaggcgatggccgcggacctgcgcgcacgcatgaaccaggatccggcc
ctggaccccatggacctgttcgcccatgtgtatgccgagcccaccccccagctgcgggag
caggaagcccagttgcgggccgagctggcagcggaggccgacgggccccaaggagtcggc
cgatga

KEGG   Streptomyces avermitilis: SAVERM_4363
Entry
SAVERM_4363       CDS       T00126                                 

Gene name
bkdB
Definition
(GenBank) putative 3-methyl-2-oxobutanoate dehydrogenase (lipoamide) (EC 1.2.4.4) E1-beta chain
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_4363 (bkdB)
   00020 Citrate cycle (TCA cycle)
    SAVERM_4363 (bkdB)
   00620 Pyruvate metabolism
    SAVERM_4363 (bkdB)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SAVERM_4363 (bkdB)
SSDB
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Other DBs
NCBI-ProteinID: BAC72075
NITE: SAV4363
UniProt: Q82F97
Position
5340982..5341986
AA seq 334 aa
MTTVALKPATMAQALTRALRDAMAADPAVHVMGEDVGTLGGVFRVTDGLAKEFGEDRCTD
TPLAEAGILGTAVGMAMYGLRPVVEMQFDAFAYPAFEQLISHVARMRNRTRGAMPLPITI
RVPYGGGIGGVEHHSDSSEAYYMATPGLHVVTPATVADAYGLLRAAIASDDPVVFLEPKR
LYWSKDSWNPDEPGTVEPIGRAVVRRSGRSATLITYGPSLPVCLEAAEAARAEGWDLEVV
DLRSLVPFDDETVCASVRRTGRAVVVHESGGYGGPGGEIAARITERCFHHLEAPVLRVAG
FDIPYPPPMLERHHLPGVDRILDAVGRLQWEAGS
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgaccaccgttgccctcaagccggccaccatggcgcaggcactcacacgcgcgttgcgt
gacgccatggccgccgaccccgccgtccacgtgatgggcgaggacgtcggcacgctcggc
ggggtcttccgggtcaccgacgggctcgccaaggagttcggcgaggaccgctgcacggac
acgccgctcgccgaggcaggcatcctcggcacggccgtcggcatggcgatgtacgggctg
cggccggtcgtcgagatgcagttcgacgcgttcgcgtacccggcgttcgagcagctcatc
agccatgtcgcgcggatgcgcaaccgcacccgcggggcgatgccgctgccgatcaccatc
cgtgtcccctacggcggcggaatcggcggagtcgaacaccacagcgactcctccgaggcg
tactacatggcgactccggggctccatgtcgtcacgcccgccacggtcgccgacgcgtac
gggctgctgcgcgccgccatcgcctccgacgacccggtcgtcttcctggagcccaagcgg
ctgtactggtcgaaggactcctggaacccggacgagccggggaccgttgaaccgataggc
cgcgcggtggtgcggcgctcgggccggagcgccacgctcatcacgtacgggccttccctg
cccgtctgcctggaggcggccgaggcggcccgggccgagggctgggacctcgaagtcgtc
gatctgcgctccctggtgcccttcgacgacgagacggtgtgcgcgtcggtgcgccggacc
ggacgcgccgtcgtcgtgcacgagtcgggtggttacggcggcccgggcggggagatcgcc
gcgcggatcaccgagcgctgcttccaccatctggaggcgccggtgctgcgcgtcgccggg
ttcgacatcccgtatccgccgccgatgctggagcgccatcatctgcccggtgtcgaccgg
atcctggacgcggtggggcggcttcagtgggaggcggggagctga

KEGG   Streptomyces avermitilis: SAVERM_4376
Entry
SAVERM_4376       CDS       T00126                                 

Gene name
bkdF
Definition
(GenBank) putative branched-chain alpha keto acid dehydrogenase E1 alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_4376 (bkdF)
   00020 Citrate cycle (TCA cycle)
    SAVERM_4376 (bkdF)
   00620 Pyruvate metabolism
    SAVERM_4376 (bkdF)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SAVERM_4376 (bkdF)
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Other DBs
NCBI-ProteinID: BAC72088
NITE: SAV4376
UniProt: Q79Z50
Position
5356305..5357525
AA seq 406 aa
MTVESTAARKPRRSAGTKSAAAKRTSPGAKKSPSTTGAEHELIQLLTPDGRRVKNPEYDA
YVADITPEELRGLYRDMVLSRRFDAEATSLQRQGELGLWASMLGQEAAQIGSGRATRDDD
YVFPTYREHGVAWCRGVDPTNLLGMFRGVNNGGWDPNSNNFHLYTIVIGSQTLHATGYAM
GIAKDGADSAVIAYFGDGASSQGDVAESFTFSAVYNAPVVFFCQNNQWAISEPTEKQTRV
PLYQRAQGYGFPGVRVDGNDVLACLAVTKWALERARRGEGPTLVEAFTYRMGAHTTSDDP
TKYRADEEREAWEAKDPILRLRTYLEASNHADEGFFAELEVESEALGRRVREVVRAMPDP
DHFAIFENVYADGHALVDEERAQFAAYQASFTTEPDGGSAAGQGGN
NT seq 1221 nt   +upstreamnt  +downstreamnt
gtgaccgtggagagcactgccgcgcgaaagccgcgacgcagcgccggtacgaagagcgcc
gcagccaagcgcaccagccccggcgccaagaagtcaccgagcacgaccggcgccgagcac
gagctgattcagctgctcacgcccgacggccggcgggtgaagaaccccgagtacgacgcg
tacgtcgcggacatcacccccgaagagctgcgcggtctgtaccgggacatggtgctgagc
cgccgcttcgacgcagaggccacctccctgcaacgccagggcgagctgggcctgtgggcc
tcgatgctcgggcaggaggccgcccagatcggctcgggccgggccacccgtgacgacgac
tacgtcttcccgacctaccgcgagcacggcgtcgcctggtgccgcggggtcgaccccacc
aacctgctcggcatgttccgcggcgtgaacaacggcggctgggatcccaacagcaacaac
ttccacctctacacgatcgtcatcggctcgcagacgctgcacgccaccggctacgccatg
ggtatcgccaaggacggcgccgactcggccgtgatcgcgtacttcggtgacggcgcctcc
agccagggtgacgtcgccgaatcgttcaccttctccgcggtctacaacgcccctgtcgtc
ttcttctgccagaacaaccagtgggcgatctccgagcccaccgagaagcagacccgcgtc
ccgctctaccagcgcgcgcagggctacggcttcccgggcgtccgcgtcgacggcaacgac
gtactggcctgcctcgccgtcaccaagtgggccctcgagcgggcccgccggggcgagggg
cccacgttggtcgaggcgttcacgtaccgcatgggcgcgcacaccacctccgacgacccg
accaagtaccgggccgacgaggagcgcgaggcgtgggaggcgaaggacccgatcctgcgt
ctgcgcacgtatctcgaggcctcaaaccacgcggacgagggattcttcgcggaactcgag
gtggagagcgaggcgttgggaaggcgagtgcgcgaagtggtgcgtgccatgccggacccg
gaccacttcgccatcttcgagaacgtgtacgcggacgggcatgcgctcgtcgacgaggag
cgggcgcagttcgccgcctaccaggcgtcgttcacgacggagcctgacggcggctccgcc
gcgggacaggggggtaactga

KEGG   Streptomyces avermitilis: SAVERM_4377
Entry
SAVERM_4377       CDS       T00126                                 

Gene name
bkdG
Definition
(GenBank) putative branched-chain alpha keto acid dehydrogenase E1 beta subunit
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_4377 (bkdG)
   00020 Citrate cycle (TCA cycle)
    SAVERM_4377 (bkdG)
   00620 Pyruvate metabolism
    SAVERM_4377 (bkdG)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SAVERM_4377 (bkdG)
SSDB
Motif
Pfam: Transket_pyr Transketolase_C
Other DBs
NCBI-ProteinID: BAC72089
NITE: SAV4377
UniProt: Q82F86
Position
5357527..5358504
AA seq 325 aa
MAEKMAIAKAINESLRKALESDPKVLIMGEDVGKLGGVFRVTDGLQKDFGEERVIDTPLA
ESGIVGTAIGLALRGYRPVVEIQFDGFVFPAYDQIVTQLAKMHARALGKIKLPVVVRIPY
GGGIGAVEHHSESPEALFAHVAGLKVVSPSNASDAYWMMQQAIQSDDPVIFFEPKRRYWD
KGEVNVEAIPDPLHKARVVREGTDLTLAAYGPMVKVCQEAAAAAEEEGKSLEVVDLRSMS
PIDFDAVQASVEKTRRLVVVHEAPVFLGTGAEIAARITERCFYHLEAPVLRVGGYHAPYP
PARLEEEYLPGLDRVLDAVDRSLAY
NT seq 978 nt   +upstreamnt  +downstreamnt
atggccgagaagatggcgatcgccaaggcgatcaacgagtcgctgcgcaaggccctggag
tccgaccccaaggttctgatcatgggtgaggacgtcggcaagctcggtggcgtcttccgc
gtcaccgacggcctgcagaaggacttcggcgaggagcgggtcatcgacaccccgctcgcc
gagtcgggcatcgtcggcacggcgatcggtctcgccctgcgcggctaccgcccggtggtg
gagatccagttcgacggcttcgtcttcccggcgtacgaccagatcgtcacgcagctcgcg
aagatgcacgcgcgggcgctcggcaagatcaagctccccgttgtcgtccgcatcccgtac
ggcggcggcatcggcgccgtcgagcaccactccgagtcccccgaggcgctcttcgcgcac
gtggcgggcctcaaggtggtctccccgtccaacgcgtcggacgcgtactggatgatgcag
caggccatccagagcgacgacccggtgatcttcttcgagccgaagcggcgctactgggac
aagggcgaggtcaacgtcgaggcgatccccgacccgctgcacaaggcccgtgtggtgcgt
gagggcaccgacctgacgctcgccgcgtacggcccgatggtgaaggtctgccaggaggcc
gcggccgccgccgaggaggagggcaagtccctggaggtcgtcgacctgcgctccatgtcg
ccgatcgacttcgacgccgtccaggcctccgtcgagaagacccgccgtctggtcgtggtg
cacgaggcgccggtgttcctgggcacgggcgcggagatcgccgcccgcatcacggagcgc
tgcttctaccacctggaggcacccgtgctgagggtcggcggctaccacgccccgtatccg
ccggcgcgtctggaagaggagtaccttccgggccttgaccgggtgctcgatgccgtcgac
cgctcgctggcgtactga

KEGG   Streptomyces avermitilis: SAVERM_5800
Entry
SAVERM_5800       CDS       T00126                                 

Gene name
aceE1
Definition
(GenBank) putative pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_5800 (aceE1)
   00020 Citrate cycle (TCA cycle)
    SAVERM_5800 (aceE1)
   00620 Pyruvate metabolism
    SAVERM_5800 (aceE1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SAVERM_5800 (aceE1)
SSDB
Motif
Pfam: PDH_E1_M Transketolase_N Transketolase_C RL
Other DBs
NCBI-ProteinID: BAC73512
NITE: SAV5800
UniProt: Q82BA5
Position
complement(7004704..7007451)
AA seq 915 aa
MASGSDRNPIIIGGLPSQVPDFDPEETQEWLDSLDAAVDERGRERARYLMLRLIERAREK
RVAVPEMRSTDYVNTIATKDEPFFPGNEEIERRILNATRWNAAVMVSRAQRPGIGVGGHI
ATFASSASLYDVGFNHFFRGKDEGDGGDQIFFQGHASPGIYARAFLLDRLDERQLDAFRQ
EKSKAPYGLSSYPHPRLMPDFWEFPTVSMGLGPLGAIFQARMNRYMEARGIADTSKSHVW
AFLGDGEMDEPESLGQLSIAAREGLDNLTFVVNCNLQRLDGPVRGNGKIIQELESQFRGA
GWNVIKLVWDRTWDPLLAQDRDGVLVNRLNTTPDGQFQTYATETGDYIRRHFFGDDHRLR
AMVEHMTDDQILHLGRGGHDHKKIFAAFSAAKAHKGQPTVILAQTVKGWTLGPNFEGRNA
THQMKKLTVADLKGFRDRLHLPISDKQLESGPPPYYHPGRDSEELQYMHDRRKGLGGYVP
TRVVRSQPLALPDDKTYAGVKKGSGQQSIATTMAFVRLLKDLMRDKEIGKRFVLIAPDEY
RTFGMDSFFPSAKIYNPLGQQYEAVDRDLLLAYKESPTGQMLHDGISEAGCTASLIAAGS
AYATHGEPLIPVYVFYSMFGFQRTGDQFWQMADQMARGFVLGATAGRTTLTGEGLQHADG
HSQLLASTNPGCVAYDPAFGFEIAHIVQDGLRRMYGSSEEYPHGEDVFYYLTVYNEPIQH
PAEPENVDVEGILKGIHRFSEGTAGSIPAQIIASGVAVPWAVEAQRILAEEWNVKADVWS
ATSWNELRREAVEVERHNLLHPEEEQRVPYVTQKLSAAEGPFVAVSDWMRSVPDQISRWV
PGTYQSLGADGFGFADTRGAARRFFHIDAQSIVVGVLTELAREGKVDRSVLKQAIDRYQL
LDVAAADPGAAGGDA
NT seq 2748 nt   +upstreamnt  +downstreamnt
gtggcttccggatccgatcgcaacccgatcatcattggcggccttccgagtcaggttcct
gacttcgatcccgaagagacccaggagtggctcgactccctcgacgccgccgtcgacgag
cggggccgggagcgggcccgctatctgatgctgcgcctgatcgagcgagcccgcgagaag
cgcgtggccgtgcccgagatgcgcagcacggactacgtcaacaccatcgccaccaaggac
gagccgttcttccccggcaacgaggagatcgagcgcaggatcctgaacgcgacccgctgg
aacgccgcggtcatggtctcgcgcgcccagcggccgggcatcggggtcggcggccacatc
gccaccttcgcctcctccgcctcgctctacgacgtgggcttcaaccacttcttccgcggc
aaggacgagggcgacggcggcgaccagatcttcttccagggccatgcctcgccgggcatc
tacgcccgcgcgttcctcctggaccggctggacgagcggcagctcgacgccttccggcag
gagaagtcgaaggcgccgtacgggctgtcctcgtacccgcacccgcggctgatgccggac
ttctgggagttcccgaccgtctccatgggcctcggcccgctcggcgcgatcttccaggcg
cggatgaaccgctacatggaggcgcgcggcatcgcggacacctccaagtcgcacgtctgg
gcgttcctcggtgacggcgagatggacgagccggagtcgctcggccagctgtcgatcgcg
gcgcgcgagggcctcgacaacctgaccttcgtcgtcaactgcaacctccagcgcctcgac
ggcccggtgcgcggcaacggcaagatcatccaggagctggagtcgcagttccggggcgcc
ggctggaacgtgatcaagctggtctgggaccgcacctgggacccgctgctcgcccaggac
cgcgacggcgtgctggtcaaccggctgaacaccacgccggacggccagttccagacgtac
gccaccgagaccggcgactacatccgtcggcacttcttcggtgacgaccaccggctgcgg
gcgatggtcgagcacatgaccgacgaccagatcctgcacctggggcgcggcggtcacgac
cacaagaagatcttcgcggcgttctcggcggccaaggcgcacaagggccagccgacggtg
atcctggcgcagacggtcaagggctggaccctcggcccgaacttcgagggccgcaacgcc
acgcaccagatgaagaagctgacggtcgccgacctcaagggcttccgcgaccgcctgcac
ctgccgatctccgacaagcagctggagtccggcccgccgccgtactaccacccgggccgc
gactcggaggagctccagtacatgcacgaccgccgcaaggggctcggcgggtacgtcccg
acgcgcgtcgtgcggtcgcagccgctggccctgccggacgacaagacgtacgcgggtgtg
aagaagggctccggtcagcagtcgatcgccacgaccatggcgttcgtacggctgctcaag
gacctcatgcgggacaaggagatcggcaagcggttcgtgctgatcgcgcccgatgagtac
cgcaccttcggcatggactcgttcttcccgagcgcgaagatctacaacccgctcggccag
cagtacgaggccgtggaccgcgacctgctgctcgcgtacaaggagtcgccgaccggccag
atgctgcacgacggcatctcggaggcgggctgtacggcctcgctgatcgccgcgggttcg
gcgtacgcgacgcacggcgaaccgctgatcccggtgtacgtcttctactcgatgttcggt
ttccagcgcaccggcgaccagttctggcagatggccgaccagatggcgcgcggtttcgtg
ctgggcgcgaccgccgggcgcacgaccctgaccggtgagggtctccagcacgcggacggc
cactcccagctgctcgcctcgaccaacccgggctgcgtcgcgtacgaccccgcgttcggc
ttcgagatcgcgcacatcgtgcaggacggcctgcgccggatgtacggctcgtccgaggag
tacccgcacggcgaggacgtcttctactacctcaccgtctacaacgagccgatccagcac
cccgccgagccggagaacgtggacgtcgagggcatcctcaagggcatccaccgcttcagc
gaaggcacggcgggctcgatcccggcgcagatcatcgcgtccggcgtcgccgtcccgtgg
gccgtcgaggcgcagcggatcctcgccgaggagtggaacgtcaaggcggacgtctggtcg
gcgacctcctggaacgagctgcggcgcgaggccgtcgaggtggagcggcacaatctgctg
caccccgaggaggagcagcgcgtcccctacgtgacgcagaagctgagcgccgccgagggt
ccgttcgtggcggtgtccgactggatgcggtcggtgcccgaccagatctcgcggtgggtg
ccggggacgtaccagtccctgggcgcggacggcttcggcttcgcggacacccgtggggcg
gcacggcgcttcttccacatcgacgcgcagtcgatcgtggtcggggtgctgaccgagctg
gcgcgcgagggcaaggtcgaccggtcggtgctgaagcaggcgatcgaccgctaccagctg
ctcgacgtggcggcggccgacccgggcgcggcgggcggcgacgcgtag

KEGG   Streptomyces avermitilis: SAVERM_6020
Entry
SAVERM_6020       CDS       T00126                                 

Gene name
aceE2
Definition
(GenBank) putative pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_6020 (aceE2)
   00020 Citrate cycle (TCA cycle)
    SAVERM_6020 (aceE2)
   00620 Pyruvate metabolism
    SAVERM_6020 (aceE2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SAVERM_6020 (aceE2)
SSDB
Motif
Pfam: PDH_E1_M Transketolase_N DUF3135 DUF5576
Other DBs
NCBI-ProteinID: BAC73732
NITE: SAV6020
UniProt: Q82AN6
Position
complement(7246738..7249440)
AA seq 900 aa
MTDPTAIQPSELDQLPDRDPEETAEWQASLDAVTQAAGPHRAAYLMRRTLERAEGNGIAL
PKLLETDYVNTIPTSAEPVVDGDEEMEHRITAWNRWNAAAMVTRGSKYGVGGHIATFASA
AWLYETGFNHFFRGKEADGSGDQLYIQGHASPGIYARAFLDGRLTEHHLDHFRQESGGNG
LPSYPHPRRLPWLWEFPTVSMGLGPLSAIYQARFNRYLTSRGIKDVSQSHVWAFLGDGEM
DEPESTAALALASREGLDNLTFVINCNLQRLDGPVRANFKIVQELEAQFRGAGWNVVKTL
WGSAWDELFQLDTTGALVRRLREVPDAQVQTYQTRDAAYIRQDFFGADPALVEMAKLIGD
DKILECFHLSRGGHESRKVYAAYRAAVSHKGAPTVILAQTVKGHTLGEGFASKNANHQMK
KLSTDEFKQMRDLLELPISDSQFVDGVVPYGHPGADSPEVRYLQERRAALGGPAPARRTH
PLAPLPAPADKTFASFDKGSGSQNVATTMAFVRLVKDLVRDKQTGRRWVPIVPDEARTFG
MESLFPSLGIYSPKGQTYEPVDRDQLMYYKEAKDGQILNEGITEAGSMADFIAASTAYST
HGEAMIPFYIFYSMFGWQRTADQMWQLGDQLGRGFLVGATAGRTTLTGEGLQHADGHSPV
IAATNPAALTYDPAFAYEIAVIVKDGLRRMYGEAAPGEDPNVFYYLTVYNEPVPQPAKPA
GLGIDEGIVKGLYRFNTAESADLSPAANAPRIQLLGSGTAIHWVLQAQRLLAEEWGVAAD
VWSATSWTELRRDALEADAALLRGEERVPFVRQALHGAEGPVLAVSDYMRQVPDQIAQWV
EQDYSSLGADGFGLSDTRDAARRHFGVDAESIVVAALAQLARRGEVKATAVKEARERYGL
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgaccgaccccaccgcaatccagccgagcgagctcgaccagctcccggaccgcgacccc
gaggagaccgccgagtggcaggcctccctggacgccgtcacccaggcggccgggccgcac
cgtgccgcgtacttgatgcgccgcacactggagcgcgccgagggcaacggcatcgcgctg
ccgaagctgctcgagacggactacgtcaacaccatccccacctccgccgagcccgtcgtg
gacggcgacgaggagatggagcaccggatcaccgcgtggaaccgctggaacgcggccgcg
atggtcacccggggcagcaaatacggcgtgggcggccacatcgccaccttcgcctccgcc
gcctggctgtacgagaccggcttcaaccacttcttcaggggcaaggaggcggacggttcc
ggtgaccagctctacatccagggccacgcctccccgggcatctacgcccgcgccttcctc
gacggccggctgaccgagcaccacctcgaccacttccgccaggagtccggcggcaacggt
ctgccgtcgtacccgcacccgcgccgtctcccctggctgtgggagttcccgacggtgtcg
atgggcctcggcccgctctccgcgatctaccaggcgcgcttcaaccgctacctgaccagc
cgcggcatcaaggacgtctcgcagtcccacgtgtgggcgttcctcggcgacggcgagatg
gacgagcccgagtcgaccgcggcactcgccctggcctcccgcgagggcctggacaacctg
accttcgtcatcaactgcaacctccagcgcctcgacggcccggtccgcgccaacttcaag
atcgtgcaggagctggaggcccagttccgcggtgccggctggaacgtcgtcaagacgctg
tggggctcggcctgggacgagctgttccagctcgacaccacgggcgccctcgtacgccgc
ctgcgcgaggtaccggacgcgcaggtgcagacgtaccagacccgcgacgccgcctacatc
cgccaggacttcttcggcgccgacccggccctcgtcgagatggcgaagctgatcggcgac
gacaagatcctcgagtgtttccacctctcccgcggtggtcacgagtcgcgcaaggtctac
gcggcctacagggcggccgtgtcccacaagggcgcgccgacggtgatcctggcccagacg
gtcaagggccacaccctcggcgagggcttcgcgtcgaagaacgccaaccaccagatgaag
aagctgtcgacggacgagttcaagcagatgcgtgacctgctggaactgcccatctccgac
agccagttcgtcgacggcgtggtgccctacggccacccgggcgccgactcccccgaggtc
cgctaccttcaggagcgccgcgcggccctcggcggcccggccccggcccgccgtacgcac
ccgctggccccgctgccggcccccgccgacaagacgttcgcgtccttcgacaagggctcc
ggctcgcagaacgtggcgacgacgatggcgttcgtccggctggtcaaggacctggtccgc
gacaagcagaccggccggcgctgggtgccgatcgtgccggacgaggcccgtaccttcggt
atggagtcgctcttcccgtccctcggcatctattcgccgaagggccagacgtacgagccg
gtcgaccgcgaccagctgatgtactacaaggaggccaaggacggccagatcctcaacgag
gggatcaccgaggccggctccatggcggacttcatcgccgcgtccaccgcgtactccacg
cacggcgaagcgatgatccccttctacatcttctactcgatgttcggctggcagcgcacg
gccgaccagatgtggcagctcggcgaccagctgggccgcggcttcctggtcggcgcgacg
gccggccgtacgacgctgacgggtgagggcctccagcacgcggacggccactcgccggtc
atcgccgcgaccaacccggcggcgctgacgtacgacccggcgttcgcgtacgagatcgcg
gtcatcgtcaaggacggtctgcgccgtatgtacggcgaggcggccccgggcgaggacccg
aacgtcttctactacctcaccgtctacaacgagccggtgccgcagcccgcgaagccggcc
ggcctcggcatcgacgagggcatcgtcaagggcctgtaccgcttcaacacggccgagtcg
gcggacctgtcccccgccgccaacgccccgcgcatccagctgctgggctccggcacggcg
atccactgggtgcttcaggcgcagcggctgctcgccgaggagtggggtgtggccgccgac
gtgtggtccgcgacctcctggaccgagctgcggcgcgacgcgctcgaggccgacgcggcg
ctgctgcgcggcgaggagcgggtgccgttcgtccgccaggcgctgcacggcgccgagggc
ccggtgctcgcggtctccgactacatgcgtcaggtcccggaccagatcgcgcagtgggtc
gagcaggactactcgtcgctcggtgcggacggcttcggcctctccgacacccgtgacgcg
gcccgccgtcacttcggcgtggacgcggagtcgatcgtcgtcgcggccctggcccagctc
gccaggcgcggcgaggtcaaggccacggcggtgaaggaggcgcgggagcgctacggcctg
tag

DBGET integrated database retrieval system