KEGG   Streptomyces avermitilis: SAVERM_4364
Entry
SAVERM_4364       CDS       T00126                                 

Gene name
bkdC
Definition
(GenBank) putative dihydrolipoamide acyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_4364 (bkdC)
   00020 Citrate cycle (TCA cycle)
    SAVERM_4364 (bkdC)
   00620 Pyruvate metabolism
    SAVERM_4364 (bkdC)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAVERM_4364 (bkdC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: BAC72076
NITE: SAV4364
UniProt: Q82F96
Position
5341986..5343353
AA seq 455 aa
MAQVLEFKLPDLGEGLTEAEIVRWLVQVGDVVAIDQPVVEVETAKAMVEVPCPYGGVVTA
RFGEEGTELPVGSPLLTVAVGAPSSVPAASSLSGATSASSASSVSSDDGESSGNVLVGYG
TSAAPARRRRVRPGQAAPVVTATAAAAATRVAAPERSDGPVPVISPLVRRLARENGLDLR
ALAGSGPDGLILRSDVEQALRAAPTPAPTPTMPPAPTPAPTPAAAPRGTRIPLRGVRGAV
ADKLSRSRREIPDATCWVDADATALMHARVAMNATGGPKISLIALLARICTAALARFPEL
NSTVDMDAREVVRLDQVHLGFAAQTERGLVVPVVRDAHARDAESLSAEFARLTEAARTGT
LTPGELTGGTFTLNNYGVFGVDGSTPIINHPEAAMLGVGRIIPKPWVHEGELAVRQVVQL
SLTFDHRVCDGGTAGGFLRYVADCVEQPAVLLRTL
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggcccaggtgctcgagttcaagctccccgacctcggggagggcctgaccgaggccgag
atcgtccgctggctggtgcaggtcggcgacgtcgtggcgatcgaccagccggtcgtcgag
gtggagacggccaaggcgatggtcgaggtgccgtgcccctacgggggcgtggtcaccgcc
cgcttcggcgaggagggcacggaactgcccgtgggctcaccgctgttgacggtggctgtc
ggagctccgtcctcggtgcccgcggcgtcctcgctgtccggggcgacatcggcgtcctcc
gcgtcctcggtgtcatcggacgacggcgagtcgtccggcaacgtcctggtcggatacggc
acgtcggccgcgcccgcgcgccggcggagggtgcggccgggccaggcggcacccgtggtg
acggcaactgccgccgcggccgccacgcgcgtggcggctcccgagcggagcgacggcccc
gtgcccgtgatctccccgctggtccgcaggctcgcccgggagaacggcctggatctgcgg
gcgctggcgggctccgggcccgacgggctgatcctgaggtcggacgtcgagcaggcgctg
cgcgccgcgcccactcctgcccccaccccgaccatgcctccggctcccactcctgccccc
acccccgccgcggcaccccgcggcacccgcatccccctccgaggggtccgcggtgccgtc
gccgacaaactctcccgcagccggcgtgagatccccgacgcgacctgctgggtggacgcc
gacgccacggcactcatgcacgcgcgcgtggcgatgaacgcgaccggcggcccgaagatc
tccctcatcgcgctgctcgccaggatctgcaccgccgcactggcccgcttccccgagctc
aactccaccgtcgacatggacgcccgcgaggtcgtacggctcgaccaggtgcacctgggc
ttcgccgcgcagaccgaacgggggctcgtcgtcccggtcgtgcgggacgcgcacgcgcgg
gacgccgagtcgctcagcgccgagttcgcgcggctgaccgaggccgcccggaccggcacc
ctcacacccggggaactgaccggcggcaccttcacgttgaacaactacggggtgttcggc
gtcgacggttccacgccgatcatcaaccaccccgaggcggccatgctgggcgtcggccgc
atcatccccaagccgtgggtgcacgagggcgagctggcggtgcggcaggtcgtccagctc
tcgctcaccttcgaccaccgggtgtgcgacggcggcacggcaggcggtttcctgcgctac
gtggcggactgcgtggaacagccggcggtgctgctgcgcaccctgtag

KEGG   Streptomyces avermitilis: SAVERM_4378
Entry
SAVERM_4378       CDS       T00126                                 

Gene name
bkdH
Definition
(GenBank) putative dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_4378 (bkdH)
   00020 Citrate cycle (TCA cycle)
    SAVERM_4378 (bkdH)
   00620 Pyruvate metabolism
    SAVERM_4378 (bkdH)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAVERM_4378 (bkdH)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Other DBs
NCBI-ProteinID: BAC72090
NITE: SAV4378
UniProt: Q82F85
Position
5358524..5359912
AA seq 462 aa
MTEASVREFKMPDVGEGLTEAEILKWYVQPGDTVTDGQVVCEVETAKAAVELPIPYDGVV
RELRFPEGTTVDVGQVIIAVDVAGDAPVAEIPVPAQEAPVQEEPKPEGRKPVLVGYGVAE
SSTKRRPRKSAPASEPAAEGTYFAATVLQGIQGELNGHGAVKQRPLAKPPVRKLAKDLGV
DLATITPSGPDGVITREDVHAAVAPPPPAPQPVQTPAAPAPAPVAAYDTARETRVPVKGV
RKATAAAMVGSAFTAPHVTEFVTVDVTRTMKLVEELKQDKEFTGLRVNPLLLIAKALLVA
IKRNPDINASWDEANQEIVLKHYVNLGIAAATPRGLIVPNIKDAHAKTLPQLAESLGELV
STAREGKTSPTAMQGGTVTITNVGVFGVDTGTPILNPGESAILAVGAIKLQPWVHKGKVK
PRQVTTLALSFDHRLVDGELGSKVLADVAAILEQPKRLITWA
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgactgaggcgtccgtgcgtgagttcaagatgcccgatgtgggtgagggactcaccgag
gccgagatcctcaagtggtacgtccagcccggcgacaccgtcaccgacggccaggtcgtc
tgcgaggtcgagaccgcgaaggcggccgtggaactccccattccgtacgacggtgtcgta
cgcgaactccgtttccccgaggggacgacggtggacgtgggacaggtgatcatcgcggtg
gacgtggccggcgacgcaccggtggcggagatccccgtgcccgcgcaggaggctccggtc
caggaggagcccaagcccgagggccgcaagcccgtcctcgtgggctacggggtggccgag
tcctccaccaagcgccgtccgcgcaagagcgcgccggcgagcgagcccgctgcggagggc
acgtacttcgcagcgaccgttctccagggcatccagggcgagctgaacggacacggcgcg
gtgaagcagcgtccgctggcgaagccgccggtgcgcaagctggccaaggacctgggcgtc
gacctcgcgacgatcacgccgtcgggccccgacggcgtcatcacgcgcgaggacgtgcac
gcggcggtggcgccaccgccgccggcaccccagcccgtgcagacgcccgctgccccggcc
ccggcgccggtggccgcgtacgacacggctcgtgagacccgtgtccccgtcaagggcgtc
cgcaaggcgacggcggcggcgatggtcggctcggcgttcacggcgccgcacgtcacggag
ttcgtgacggtggacgtgacgcgcacgatgaagctggtcgaggagctgaagcaggacaag
gagttcaccggcctgcgggtgaacccgctgctcctcatcgccaaggcgctcctggtcgcg
atcaagcggaacccggacatcaacgcgtcctgggacgaggcgaaccaggagatcgtcctc
aagcactatgtgaacctgggcatcgcggcggccaccccgcgcggtctgatcgtcccgaac
atcaaggacgcccacgccaagacgctgccgcaactggccgagtcactgggtgagttggtg
tcgacggcccgcgagggcaagacgtccccgacggccatgcagggcggcacggtcacgatc
acgaacgtcggcgtcttcggcgtcgacacgggcacgccgatcctcaaccccggcgagtcc
gcgatcctcgcggtcggcgcgatcaagctccagccgtgggtccacaagggcaaggtcaag
ccccgacaggtcaccacgctggcgctcagcttcgaccatcgcctggtcgacggcgagctg
ggctccaaggtgctggccgacgtggcggcgatcctggagcagccgaagcggctgatcacc
tgggcctag

DBGET integrated database retrieval system