KEGG   Streptomyces avermitilis: SAVERM_440
Entry
SAVERM_440        CDS       T00126                                 

Gene name
rpoA2
Definition
(GenBank) putative RNA polymerase alpha subunit
  KO
K03040  DNA-directed RNA polymerase subunit alpha [EC:2.7.7.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    SAVERM_440 (rpoA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sma03021]
    SAVERM_440 (rpoA2)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_440 (rpoA2)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     SAVERM_440 (rpoA2)
Transcription machinery [BR:sma03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     SAVERM_440 (rpoA2)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      SAVERM_440 (rpoA2)
SSDB
Motif
Pfam: RNA_pol_A_CTD RNA_pol_A_bac RNA_pol_L
Other DBs
NCBI-ProteinID: BAC68150
NITE: SAV0440
UniProt: Q82QR5
Position
594232..595248
AA seq 338 aa
MLIAQRPSLTEEVVDEFRSRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRVDGVL
HEFTTVPGVKEDVTDLILNIKQLVVSSEHDEPVVMYLRKQGPGLVTAADIAPPAGVEVHN
PDLVLATLNGKGKLEMELTVERGRGYVSAVQNKQVGQEIGRIPVDSIYSPVLKVTYKVEA
TRVEQRTDFDKLIVDVETKQAMRPRDAMASAGKTLVELFGLARELNIDAEGIDMGPSPVD
AALAADLVMPIEELELTVRSYNCLKREGVHSVGELVARSEADLLDIRNFGAKSIDEVKAK
LAGMGLGLKDSPPGFDPTAAALGADDDADAGFLETEHY
NT seq 1017 nt   +upstreamnt  +downstreamnt
gtgctgattgctcagcgtccgtccctgaccgaagaggtcgtcgacgagttccgctcccgg
ttcgtgatcgagccgctggagccgggcttcggctacaccctcggcaactccctccgccgg
accctcctgtcctcgatcccgggtgcggcggtcacgtccatccgcgtcgacggcgttctg
cacgagttcaccaccgtgccgggtgtcaaggaggacgtcaccgacctgatcctcaacatc
aagcagctggtcgtctcctcggagcacgacgagccggtcgtgatgtacctgcgcaagcag
ggtccgggtctggtcaccgccgccgacatcgcgcccccggccggtgtcgaggtgcacaac
cccgacctcgtcctcgccacgctcaacggcaagggcaagctggagatggagctgaccgtc
gagcgcggtcgcggctacgtctccgccgttcagaacaagcaggtcggtcaggagatcggg
cgcatcccggtcgactcgatctactcgccggtgctgaaggtcacgtacaaggtcgaggcg
acccgtgtcgagcagcgcaccgacttcgacaagctgatcgtcgacgtcgagaccaagcag
gccatgcgtccccgtgacgccatggcgtcggccggcaagacgctggtcgagctgttcggt
ctcgcccgcgagctcaacatcgacgccgagggcatcgacatgggcccgtccccggtggac
gccgccctcgccgccgacctggtgatgccgatcgaggagctggagctcacggtccggtcg
tacaactgcctcaagcgcgagggcgtccactccgtgggtgagctcgtcgcccgctccgag
gccgacctcctggacatccgcaacttcggtgcgaagtccatcgacgaggtcaaggcgaag
ctggccggcatgggcctgggcctcaaggacagcccgcccggattcgacccgaccgccgcc
gcactcggtgcggacgacgacgcggacgcgggtttcctggagacggagcattactga

DBGET integrated database retrieval system