KEGG   Streptomyces avermitilis: SAVERM_4403Help
Entry
SAVERM_4403       CDS       T00126                                 

Gene name
metS
Definition
(GenBank) putative methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sma  Streptomyces avermitilis
Pathway
sma00450  Selenocompound metabolism
sma00970  Aminoacyl-tRNA biosynthesis
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SAVERM_4403 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAVERM_4403 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_4403 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sma03016]
    SAVERM_4403 (metS)
Enzymes [BR:sma01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SAVERM_4403 (metS)
Amino acid related enzymes [BR:sma01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SAVERM_4403 (metS)
Transfer RNA biogenesis [BR:sma03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SAVERM_4403 (metS)
 Prokaryotic type
   Other AARSs
    SAVERM_4403 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: BAC72115
NITE: SAV4403
UniProt: Q82F60
Position
complement(5383799..5385523)
Genome map
AA seq 574 aa AA seqDB search
MARHLITSALPYINGIKHLGNMVGSMLPADVYSRYLRQRGHDVLYICATDEHGTPAELAA
KERGLPVDEFCAQAHDAQKAVYDGFELAFDYFGRSSSEQNREITQHFARRLNENGFIEER
AIRQVYSPADGRFLPDRYVEGTCPHCGYDKARGDQCENCTRVLDPTDLINPRSAISGSTD
LEVRETKHLFLLQSKLQHEVEEWVARHEEEWPQLASSIARKWLNEGLHDRAITRDLDWGV
PVPADTWPELAAEGKVFYVWFDAPIEYIGATKEWSDLDPENRDWKSWWYDADSGENPVRY
TEFMAKDNVPFHTVMFPATELGVREPWKKVDYVKAFNWLTYYGGKFSTSQKRGVFTDHAL
EILPADYWRYFLIANAPESDDSSFTWEHFTATVNKDLADTLGNFVNRVLSFSKKRFGEEV
PAGAPAGESETKLGEEIAALLAEYESHMETLQFRKAAAALRALWSAGNSYLEEKAPWLEI
KTNPEGAALTLRTAMNLIHLYSVVSEPFIPASSKAMRSAFALSEDTATWVTQDEAKSLDS
VPAGTPFTVPPVLFAKITDEDLESYKERFGGAPE
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggctcgacacctcatcaccagcgcccttccgtacatcaacgggatcaagcacctgggc
aacatggtggggtccatgctcccggcggacgtgtactcccggtacctccgccagcgcggc
cacgacgtcctgtacatctgcgcgacggacgagcacggcacgccggccgagctggcggcg
aaggagcggggcctcccggtcgacgagttctgcgcgcaggcgcacgacgcgcagaaggcg
gtgtacgacggcttcgagctggccttcgactacttcggccgcagctccagcgagcagaac
cgcgagatcacccagcacttcgcccgccgcctgaacgagaacggcttcatcgaggagcgc
gcgatccgccaggtgtactccccggcggacggccgcttcctgcccgaccgctacgtggag
ggcacctgcccccactgcggttacgacaaggcccgcggcgaccagtgcgagaactgcacg
cgcgtcctggacccgaccgacctcatcaacccccgctcggcgatctccggctcgacggac
ctggaggtccgggagacgaagcacctcttcctcctccagtcgaagctccagcacgaggtc
gaggagtgggtcgcccgccacgaggaggagtggccgcagctggcgtcctccatcgcccgc
aagtggctgaacgaggggctgcacgaccgcgcgatcacccgtgacctggactggggtgtc
ccggtcccggccgacacctggccggagctggccgccgagggcaaggtcttctacgtctgg
ttcgacgcaccgatcgagtacatcggggcgacgaaggagtggtcggacctggacccggag
aaccgtgactggaagtcgtggtggtacgacgccgactccggcgagaacccggtccgctac
acggagttcatggcgaaggacaacgtccccttccacaccgtcatgttcccggccacggaa
ctcggcgtgcgcgagccgtggaagaaggtcgactacgtcaaggcgttcaactggctgacg
tactacggcggaaagttctccacgtcccagaagcgcggcgtcttcacggaccacgcgctg
gagatcctccccgcggactactggcgctacttcctgatcgccaacgcgccggagtcggac
gactcgtcgttcacgtgggagcacttcacggcgacggtcaacaaggacctggcggacacg
ctgggcaacttcgtgaaccgcgtcctgtccttctcgaagaagcgcttcggcgaggaggtc
cccgcgggtgccccggccggcgagtcggagacgaagctgggcgaggagatcgcggccctg
ctcgcggagtacgagtcgcacatggagacgctccagttccgcaaggcggccgccgccctg
cgcgccctgtggtcggcgggcaactcctacctggaggagaaggctccctggctggagatc
aagaccaaccccgagggcgcggcgctgaccctgcgtacggcgatgaacctgatccacctc
tactcggtggtctcggagcccttcatccccgcctcctccaaggccatgcgctcggcgttc
gcgctgagcgaggacacggcgacgtgggtgacgcaggacgaggcgaagtccctggactcg
gtcccggcgggcacgccgttcaccgtccccccggtcctcttcgccaagatcactgacgag
gacctggagtcgtacaaggagcgcttcggcggcgcaccggagtaa

DBGET integrated database retrieval system