KEGG   Streptomyces avermitilis: SAVERM_4452Help
Entry
SAVERM_4452       CDS       T00126                                 

Gene name
blaA3
Definition
(GenBank) putative beta-lactamase (ampC), secreted
  KO
K17836  beta-lactamase class A [EC:3.5.2.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00311  Penicillin and cephalosporin biosynthesis
sma01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SAVERM_4452 (blaA3)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SAVERM_4452 (blaA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:sma01504]
    SAVERM_4452 (blaA3)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     SAVERM_4452 (blaA3)
Antimicrobial resistance genes [BR:sma01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    SAVERM_4452 (blaA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: BAC72164
NITE: SAV4452
UniProt: Q82F11
Position
5436525..5437490
Genome map
AA seq 321 aa AA seqDB search
MAGDTAGDTTWTAPGPGRRAVLTLGAGTMLAAALSRGGRAYAATPGGGASGARSERLYGR
LRELEREHSARLGVFARDMATGRTLLYRADERFPVCSVFKTLAAAAVLRDLDHDGEFLAR
RIRYTEQYVKDSGYGPVTGRAENLAAGMTVAELCAAAVSDSDNAAGNLLLRELGGPTAIT
GFCRSIGDGRTRLDRWEPDLNSAEPWRDTDTTSPRAIGKTYARLILGDVLPPQDRTRLTN
WLIANTTNTARFRAGLPADWILADKTGGGNSYGVANDVGVVWPPNRSPIVMTVLTTKHAA
AGPSDSPLVARTAELLAAELT
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgacacggctggcgacacgacgtggaccgcgccgggacccggccgtcgcgcg
gtactgaccctcggcgcggggacgatgctcgccgccgccctgtcccggggcgggagggcc
tacgccgcgacccccggtggaggggcgtccggggcgcggtccgaacggttgtacgggcgg
ctgagggaactcgaacgggagcattccgcccgtctgggcgtgttcgcccgcgacatggcc
acgggcagaaccctgctgtaccgcgcggacgaacggttcccggtctgctccgtcttcaag
accctggcggccgcggccgtgctgcgggacctcgatcacgacggcgagttcctcgcccgg
cgcatccggtacacggagcagtacgtcaaggactccggctacggcccggtcaccggcagg
gccgagaacctcgcggccggtatgaccgtcgcggaactgtgcgccgccgccgtcagcgac
agtgacaacgcggcgggcaaccttctcctgcgcgaactcggcggccccacggccatcacc
ggcttctgccgttcgatcggcgacgggaggacccggctcgaccggtgggaacccgacctg
aactcggcggagccgtggcgtgacaccgacaccaccagcccccgcgccatcggaaagacg
tacgcgcgcctcatcctcggtgacgtcctcccgccccaggaccggacccggctgacgaac
tggctgatcgccaacaccaccaacaccgcgcgtttccgggccggccttccggcggactgg
atcctggcggacaagacgggcggcgggaacagttacggggtcgccaacgacgtgggtgtc
gtatggcctccaaaccggtcaccgatcgtcatgaccgtcctgacgaccaaacacgcggct
gccggacccagcgacagcccgctggtggcgaggaccgccgagctgctggcggcggaactc
acctga

DBGET integrated database retrieval system