KEGG   Streptomyces avermitilis: SAVERM_4484Help
Entry
SAVERM_4484       CDS       T00126                                 

Gene name
dnaK1
Definition
(GenBank) putative heat shock protein Hsp70
  KO
K04043  molecular chaperone DnaK
Organism
sma  Streptomyces avermitilis
Pathway
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_4484 (dnaK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sma03019]
    SAVERM_4484 (dnaK1)
   03110 Chaperones and folding catalysts [BR:sma03110]
    SAVERM_4484 (dnaK1)
   03029 Mitochondrial biogenesis [BR:sma03029]
    SAVERM_4484 (dnaK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_4484 (dnaK1)
Messenger RNA biogenesis [BR:sma03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     SAVERM_4484 (dnaK1)
Chaperones and folding catalysts [BR:sma03110]
 Heat shock proteins
  HSP70 / DNAK
   SAVERM_4484 (dnaK1)
Mitochondrial biogenesis [BR:sma03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    SAVERM_4484 (dnaK1)
  Matrix
   MMC/PAM proteins
    SAVERM_4484 (dnaK1)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SAVERM_4484 (dnaK1)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SAVERM_4484 (dnaK1)
  Exosomal proteins of breast cancer cells
   SAVERM_4484 (dnaK1)
  Exosomal proteins of colorectal cancer cells
   SAVERM_4484 (dnaK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA
Motif
Other DBs
NCBI-ProteinID: BAC72196
NITE: SAV4484
UniProt: Q82EX9
Position
5479054..5480922
Genome map
AA seq 622 aa AA seqDB search
MARAVGIDLGTTNSVVSVLEGGEPTVITNAEGARTTPSVVAFAKNGEVLVGEVAKRQAVT
NVDRTVRSVKRHMGTDWKINLDGKDFNPQQMSAFILQKLKRDAEAYLGEKVTDAVITVPA
YFNDSERQATKEAGEIAGLNVLRIVNEPTAAALAYGLDKDDQTILVFDLGGGTFDVSLLE
IGDGVVEVKATNGDNHLGGDDWDQRVVDYLVQQFKAGHGVDLAKDKMALQRLREAAEKAK
IELSSSTETSINLPYITASAEGPLHLDEKLTRAQFQQLTADLLERCKTPFHNVIKDAGIN
LSEIDHVVLVGGSTRMPAVAELVKELTGGQDANKGVNPDEVVAIGAALQAGVLKGEVKDV
LLLDVTPLSLGIETKGGIMTKLIERNTTIPTKRSEIFTTAEDNQPSVQIQVYQGEREIAA
YNKKLGMFELTGLPPAPRGVPQIEVAFDIDANGIMHVTAKDLGTGKEQKMTVTGGSSLPK
DEVDRMRQEAEQYADEDHRRREAAETRNQGEQLVYQTEKFLKDNEDKVPGEVKTEVEASI
EELKAALKGESAEGDNTAEIRTATEKVAAVSQKLGQAMYADAQAAQAAGGAEGAAGGEHA
KAADDDVVDAEIVDEDRKDGAA
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtgcggtcggcatcgacctgggcacgactaactccgtcgtcagcgttctggag
ggcggcgagcccaccgtcatcaccaacgccgagggcgccaggaccacgccgtccgtcgtc
gccttcgccaagaacggtgaggtgctcgtcggcgaggtcgccaagcgtcaggcggtcacg
aacgtcgacaggacggttcgttcggtcaagcgccacatgggcactgactggaagatcaac
ctggacggcaaggacttcaacccgcagcagatgagcgccttcatcctgcagaagctgaag
cgggacgccgaggcctacctgggcgagaaggtcacggacgcggtcatcaccgtcccggcg
tacttcaacgactcggagcgccaggcgacgaaggaggccggcgagatcgccggtctgaac
gtcctgcgcatcgtcaacgagccgacggccgccgccctggcctacggcctcgacaaggac
gaccagaccatcctcgtcttcgacctcggtggcggcacgttcgacgtgtccctcctggag
atcggcgacggcgtcgtcgaggtgaaggccaccaacggtgacaaccacctcggtggcgac
gactgggaccagcgtgtcgtcgactacctggtgcagcagttcaaggccggccacggtgtg
gacctggccaaggacaagatggccctccagcgcctccgcgaggccgccgagaaggccaag
atcgagctgtcctcgtccaccgagacctcgatcaacctgccctacatcacggcgtccgcc
gagggcccgctgcacctggacgagaagctcacgcgcgcccagttccagcagctcaccgct
gaccttctggagcgctgcaagacgccgttccacaacgtcatcaaggacgcgggcatcaac
ctctccgagatcgaccacgtcgttctcgtcggtggctccacccgtatgcccgccgtcgcc
gagctcgtcaaggagctgaccggcggccaggacgccaacaagggcgtgaacccggacgag
gtcgtcgccatcggcgcggccctccaggccggtgtcctcaagggtgaggtcaaggacgtc
ctgctcctcgacgtgaccccgctgtccctcggtatcgagaccaagggcggcatcatgacc
aagctcatcgagcgcaacaccacgatcccgaccaagcggtccgagatcttcacgacggcc
gaggacaaccagccgtccgtgcagatccaggtctaccagggcgagcgcgagatcgcggcg
tacaacaagaagctcgggatgttcgagctgaccggtctgccgccggccccgcgcggggtc
ccgcagatcgaggtcgccttcgacatcgacgccaacggcatcatgcacgtgaccgcgaag
gacctgggcacgggcaaggagcagaagatgaccgtcaccggcggctcctcgctgccgaag
gacgaggtcgaccggatgcgccaggaggccgagcagtacgcggacgaggaccaccgtcgc
cgcgaggccgccgagacccgcaaccagggcgagcagctcgtctaccagacggagaagttc
ctcaaggacaacgaggacaaggtccccggcgaggtcaagaccgaggtcgaggcgtccatc
gaggagctgaaggccgcgctcaagggcgagtccgccgaaggcgacaacaccgccgagatc
cgtacggccaccgagaaggtcgccgctgtctcgcagaagctgggccaggcgatgtacgcc
gacgcccaggccgcgcaggcggcgggcggcgccgagggtgccgccggcggcgagcacgcc
aaggccgctgacgacgacgtcgtcgacgccgagatcgtcgacgaggaccgcaaggacggt
gccgcgtga

KEGG   Streptomyces avermitilis: SAVERM_7237Help
Entry
SAVERM_7237       CDS       T00126                                 

Gene name
dnaK2
Definition
(GenBank) putative heat shock protein Hsp70
  KO
K04043  molecular chaperone DnaK
Organism
sma  Streptomyces avermitilis
Pathway
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_7237 (dnaK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sma03019]
    SAVERM_7237 (dnaK2)
   03110 Chaperones and folding catalysts [BR:sma03110]
    SAVERM_7237 (dnaK2)
   03029 Mitochondrial biogenesis [BR:sma03029]
    SAVERM_7237 (dnaK2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_7237 (dnaK2)
Messenger RNA biogenesis [BR:sma03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     SAVERM_7237 (dnaK2)
Chaperones and folding catalysts [BR:sma03110]
 Heat shock proteins
  HSP70 / DNAK
   SAVERM_7237 (dnaK2)
Mitochondrial biogenesis [BR:sma03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    SAVERM_7237 (dnaK2)
  Matrix
   MMC/PAM proteins
    SAVERM_7237 (dnaK2)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SAVERM_7237 (dnaK2)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SAVERM_7237 (dnaK2)
  Exosomal proteins of breast cancer cells
   SAVERM_7237 (dnaK2)
  Exosomal proteins of colorectal cancer cells
   SAVERM_7237 (dnaK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA Hydantoinase_A FtsA FGGY_C
Motif
Other DBs
NCBI-ProteinID: BAC74948
NITE: SAV7237
UniProt: Q826F6
Position
8630200..8632101
Genome map
AA seq 633 aa AA seqDB search
MAKAVGIDLGTTNSVIAVWEGGEPSVVPNSEGNRTTPSVVAFTDTGERLVGQLARRQAIL
NPKGTIYSAKRFIGRHFDEISDEARAVTYDVVEGDGGAARFKVRDKLYAPEEISAQVLRK
LADDASKQLGERVTEAVITVPAYFNDAQRTATKDAGRIAGLEVLRIINEPTAAALAYGMD
KKEHETVLVFDLGGGTFDVSILDVGDGVVEVRSTAGDSHLGGDDFDRRLVDYLADDFQQE
NGIDLRKDPQALQRLFEAAEKAKTELSSVTQTQVSLPFITADASGPKHLTDTVMRSTFEQ
ITSDLVERCLGPVQQAMADAKVGESDIDEVILVGGSTRIPAVQALVRRLTGGKDPNMSVN
PDEVVALGAAIQAGVLKGEVKDVLLLDVTPLSLGVETRGGVMTKIIERNTTIPVRRSETF
STAEDNQPAVDVVVLQGERERAADNRVLGRFQLTDIRPAPRGEPQVEVTFDIDANGILNV
TARDKDTGKEQGITISESSNLDRSEVERMVQEAERNQGQDQALREAVDARNELDAVAYQV
EKRLAELGDAAPAHEKARAEMLVSDARAAVKEEAGVERVRPLTSELQQVLAGLAAHQGAA
TADGGPAQHAATGGPTSGGGGGDDVIDAEFDKG
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcagtgggcatcgacctgggcaccaccaactcggtgatcgccgtgtgggag
ggcggcgagccgtccgtcgtacccaacagcgagggcaaccgcacgacaccgtccgtggtg
gccttcaccgacaccggggaacgcctggtgggccagctggcccggcgccaggcgatcctc
aacccgaagggcaccatctactcggccaagcggttcatcggccggcacttcgacgagatc
tccgacgaggccagggcggtgacgtacgacgtcgtcgagggcgacggcggggcggcccgc
ttcaaggtgcgcgacaagctgtacgcgcctgaggagatcagcgcacaggtgctgcgcaaa
ctcgccgacgacgcctccaagcagctcggggagcgggtcacggaggcggtcatcacggtg
cccgcctacttcaacgacgctcagcgcaccgccaccaaggacgccggacggatcgcggga
ctggaggtgctgcggatcatcaacgagccgacggcggccgccctcgcgtacggcatggac
aagaaggagcacgagaccgtcctcgtcttcgacctgggcggcggcaccttcgacgtgagc
atcctcgacgtcggcgacggcgtggtggaggtgcgctccaccgccggcgacagccacctg
ggcggcgacgacttcgaccgccgtctggtggattacctcgcggacgacttccagcaggag
aacggcatcgacctgcgcaaggacccgcaggcgctgcaacgactgttcgaggcggcggag
aaggccaagaccgagctcagttcggtgacgcagacgcaggtcagcctgccgttcatcacc
gccgacgcctcgggccccaagcacctcaccgacacggtcatgcggtccacgttcgagcag
atcaccagcgacctggtggagcgttgcctgggaccggtccagcaggcgatggccgacgcc
aaggtcggcgagagcgacatcgacgaggtcatcctcgtaggcggttccacacgtatcccg
gcggtgcaggctctggtccgccgactgaccggcggcaaggacccgaacatgagcgtcaac
cccgacgaggtcgtcgccctgggcgccgcgatccaggccggggtgctcaagggcgaggtc
aaggacgtcctgctgctcgacgtcacacccttgtcgctgggcgtggagacgcgcggtgga
gtgatgacgaagatcatcgagcggaacaccaccatcccggtgcgtcgcagcgagaccttc
tccaccgccgaggacaatcagccggccgtcgatgtggtggtcctccagggcgagcgcgag
cgggccgccgacaaccgggtgctgggccggttccagctcaccgacatccggccggcgccg
cggggcgaaccgcaggtcgaggtcaccttcgacatcgacgccaacggcatcctcaacgtc
accgcacgggacaaggacaccggcaaggaacagggcatcaccatcagcgagagctccaac
ctggaccgcagcgaggtcgaacgcatggtccaggaggccgagcgcaaccagggccaggac
caggcactccgcgaggccgtcgacgcccgcaacgaactcgacgccgtcgcgtaccaggtc
gagaagcgcctcgccgaactgggcgacgcggcgcccgcgcacgagaaggcacgcgccgag
atgctcgtgtccgacgcccgggcggcggtcaaggaagaggcgggcgtggagcgcgtgcgg
cccctgacctccgaactccagcaggtgctcgccggactggcggcccatcagggcgccgcc
accgcggatggcggtcccgcccagcacgccgccaccggtggtcccacgagcggcggtggc
ggtggcgacgatgtcatcgacgccgagttcgacaagggctga

DBGET integrated database retrieval system