KEGG   Streptomyces avermitilis: SAVERM_4519
Entry
SAVERM_4519       CDS       T00126                                 

Gene name
speE
Definition
(GenBank) putative spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
sma  Streptomyces avermitilis
Pathway
sma00270  Cysteine and methionine metabolism
sma00330  Arginine and proline metabolism
sma00480  Glutathione metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAVERM_4519 (speE)
   00330 Arginine and proline metabolism
    SAVERM_4519 (speE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SAVERM_4519 (speE)
Enzymes [BR:sma01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     SAVERM_4519 (speE)
SSDB
Motif
Pfam: Spermine_synth Methyltransf_25 MTS Methyltransf_11
Other DBs
NCBI-ProteinID: BAC72231
NITE: SAV4519
UniProt: Q82EU4
Position
5521235..5522881
AA seq 548 aa
MIEPHAPAPPGAAPPWGGQSRPWLPVRPGVGRFFVLAGVFVCAACGLVYELELVALASYL
IGDSVTQASVVLSVMVFAMGIGSLAAKRLRPHAAAGFGAIEAALALVGGSSAMALYAVFA
WTGDWGGVWAGGPRCLLVAFSLAIGLLIGAEVPLLMELIQRIRRQDAGGAVADLFAADYV
GALVGGLAFPFLLLPLLGQLEGVLLTGTVNALAGGALVLGLFRRDLTRRGRWLLIVVNLV
VLGLLATAAVLVDDFERAARQAVYGRDVRVALQTGVQEVVLTGGTRGRPLDLFLDGRLRV
SGHDERRYHEALVHPAMSDGRHARVLVLGGGDGLAAREVLRYADVARVDVVELDAGVVRL
ARRDPALSSLNAHAYDDPRVHVVTADAFCRLRHTRSAYDVVISDLPDPGITASTKLYSQE
FYGLVSRVLAPGGRLVVHAGPVASRPRAYWTVEATVRAAGLRTVPYRVGGRDTGFAAGPD
RSTDASRAPRDWGFVLASRTGPALSLGPGGPRLRTLTRASLAADALDPGRARPPDVAPST
LVHPRYAD
NT seq 1647 nt   +upstreamnt  +downstreamnt
gtgatcgaaccgcacgcgcctgcaccgcccggcgccgcgcccccgtggggcggccagagc
cggccgtggctgcccgtacggcccggtgtcggacggttcttcgtcctggccggcgttttc
gtctgcgcggcctgtggactcgtgtacgaactcgaactcgtcgcgctcgcctcgtacttg
atcggtgactcggtcacccaggcttccgtcgtgctctccgtgatggtcttcgcgatgggc
atcggctcgctcgccgcgaagcggctgcgcccgcacgccgccgccggtttcggcgcgatc
gaggcggcgctcgcgctggtcggcggctccagcgccatggcgctgtacgcggtgttcgcc
tggaccggcgactggggcggggtgtgggcgggcggcccccgctgcctcctcgtcgccttc
tccctcgccatcggcctgctgatcggcgccgaagtccccctgctgatggagctgatccag
cgcatccggcgccaggacgcgggcggcgcggtggcggacctgttcgccgcggactacgtg
ggcgcgctggtgggcggactggcgttcccgttccttctcctgcccctgctcggccagttg
gagggcgtactgctcaccggcacggtcaacgcgctggccggcggtgcactcgtactgggg
ctgttccggcgggacttgacccggcgcggccgctggctgctgatcgtcgtcaacctggtc
gtcctcggcctgctcgccacggcggcggtcctggtcgacgacttcgaacgggcggcacgc
caggccgtgtacggcagggacgtccgcgtggccctgcagacgggcgtccaggaggtggtg
ctgaccggcggcacccgcgggcgccccctcgacctcttcctcgacggccgcctgcgggtc
agcggccatgacgagcgccgctatcacgaggcactcgtccaccccgcgatgagcgacggc
cggcacgcgcgcgtgctcgtcctcggcggcggtgacggcctcgcggcccgcgaggtgctg
cggtacgcggacgtggcgcgggtcgacgtggtcgaactggacgcgggcgtcgtacggctg
gcccgccgcgacccggccctgtccagcctcaacgcacacgcgtacgacgacccgcgggtg
cacgtcgtgacggcggacgcgttctgccggctgcggcacacccgttcggcgtacgacgtg
gtgatctcggacctcccggacccgggcatcacggcgagtacgaagctgtactcgcaggag
ttctacggcctggtgagccgggtgctggcccccggcggccggctggtggtccacgcggga
ccggtcgcctcccgcccccgggcctactggacggtcgaggcgaccgtccgggccgcgggg
ctgcgcaccgtgccgtaccgcgtgggcggccgggacacgggcttcgcggcgggccccgac
cgctcgaccgacgcgtcccgggcaccgcgcgactggggcttcgtcctcgcctcccgtacg
ggcccggccctcagcctcggcccgggcgggccgaggctgcgtacgctcacccgggcgtcg
ctggccgcggacgcgctggacccgggccgcgcccgtccgccggacgtggcaccgtcgacg
ctggtgcacccgaggtacgcggactga

DBGET integrated database retrieval system