KEGG   Streptomyces avermitilis: SAVERM_4521
Entry
SAVERM_4521       CDS       T00126                                 

Definition
(GenBank) hypothetical protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00052  Galactose metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Module
sma_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_4521
   00052 Galactose metabolism
    SAVERM_4521
Enzymes [BR:sma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SAVERM_4521
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-ProteinID: BAC72233
NITE: SAV4521
UniProt: Q82EU2
Position
5524053..5524841
AA seq 262 aa
MSNDEITLTAGDAEVALVPGSGGRVRSLRVGGVELLRQGERYGCFPMVPWCGRIRDGKFR
NGATLHQMPLNSPPHAIHGTARDGAWRVARTGKNEAVLTYDLVEPWPYPGRVTQIAALTE
DSLTLTMSVEAYDSSFPAQIGWHPWFNRNLGQDDARVDFTPAWQEERGADHLPTGNRVAP
LPGPWDDCFGMPDGVHVTLSWPGQLELTVASREEWVVVYDEQPEAVCVEPQTGPPDGLNT
RPRLVTPIEPLEATTTWTWRTL
NT seq 789 nt   +upstreamnt  +downstreamnt
gtgagtaacgacgagatcacgctgaccgcgggcgacgcggaagtggccctggtaccggga
agcggcggacgcgtgcgcagcctgcgcgtcggcggggtggaactgctgcggcagggcgag
cgctacggctgcttcccgatggttccgtggtgcggccggatcagggacggcaagttccgc
aacggcgccaccctccaccagatgcccctcaactccccgccgcacgccatccacggcacc
gccagggacggcgcctggcgcgtcgcgcgcaccggcaagaacgaggccgtcctcacgtac
gacctcgtcgagccgtggccctaccccggccgcgtcacccagatcgccgccctgaccgag
gactccctcacgctcaccatgagcgtggaggcgtacgactcctcgttcccggcccagatc
ggctggcacccctggttcaaccggaacctggggcaggacgacgcacgcgtcgacttcacc
cccgcctggcaggaggagcgcggcgccgaccacctccccaccggcaaccgcgtcgccccc
ctccccggcccttgggacgactgcttcggcatgcccgacggcgtccacgtcaccctcagt
tggcccgggcagctggagctcaccgtcgcctcccgcgaggagtgggtcgtcgtgtacgac
gaacagcccgaggccgtctgtgtggagccgcagaccggcccgcccgacggactcaacacc
cgtccgcgcctggtcacacccatcgagccgctggaagccacgaccacctggacgtggcgg
acgctgtag

KEGG   Streptomyces avermitilis: SAVERM_5766
Entry
SAVERM_5766       CDS       T00126                                 

Gene name
galM1
Definition
(GenBank) putative aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00052  Galactose metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Module
sma_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_5766 (galM1)
   00052 Galactose metabolism
    SAVERM_5766 (galM1)
Enzymes [BR:sma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SAVERM_5766 (galM1)
SSDB
Motif
Pfam: Aldose_epim TAT_signal
Other DBs
NCBI-ProteinID: BAC73478
NITE: SAV5766
UniProt: Q82BD9
Position
complement(6970843..6971994)
AA seq 383 aa
MELNRRTLIAGTAAAGIAATTLGGTAQAAPGSGRPVKELFGKLADGTKIYRWSLENGGTR
LKVLSYGGIVQSLEIPDRHGRYKNVSLGFATIEDYVAKTPYFGALIGRYGNRIAKGRFDL
DGKSYQLSVNDGVNSLHGGAKGFDKRPWDIEGFTSGSDVGLHLYYTSVDGEMGYPGTLKA
KVTYTLTRHGDWRIDYEATTDKATVVNLTSHVYWNLAGEGSGSIYDHELKIAAARYTPVD
SGLIPTGELAKVAGTPFDFRRTKTVGEDIREANQQLLYGKGIDHNWVLDKGITAKPAHVA
TLRDPSSGRTLRIATTEPGLQFYSGNFLDGTLVGPGGHIYRQGDALCLETQHFPNSPNQP
AFPSTVLRPGETYRSSTVHSFDA
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggaactgaacagacgcacactcatcgcgggcaccgcggccgcgggcatcgcggcgacc
acgctcggcgggacggcacaggccgccccgggaagcggaaggccggtgaaggagctcttc
ggcaagctcgccgacgggacgaagatctaccgctggtcgctggagaacggcggcacccgg
ctgaaggtcctgtcgtacggcggcatcgtccagtccctggagatcccggaccggcacggc
cgctacaagaacgtgtcgctgggcttcgccaccatcgaggactacgtcgcgaagaccccg
tacttcggcgcgctcatcggccggtacggaaaccgtatagccaagggccggttcgacctc
gacggcaagtcctaccagctgtccgtcaacgacggggtcaacagcctgcacggcggcgcc
aagggcttcgacaagcgcccctgggacatcgagggcttcacctccggttcggacgtgggc
ctgcacctgtactacacgagcgtcgacggcgagatgggctacccgggcacgctcaaggcg
aaggtcacctacacgctgaccaggcacggcgactggcgcatcgactacgaggccaccacc
gacaaggccaccgtcgtcaacctcaccagccatgtctactggaacctggcgggcgagggc
agcggctcgatctacgaccacgaactgaagatcgccgccgcccgctacacccccgtcgac
tcgggcctgatccccaccggtgagctggccaaggtcgcgggcacccccttcgacttccgc
cgtacgaagaccgtcggcgaggacatccgagaggcgaaccagcagctcctgtacggcaag
ggcatcgaccacaactgggtcctcgacaaggggatcacggcgaagcccgcgcacgtcgcg
acgctccgggacccgtcctcgggccgcacgctgaggatcgcgacgaccgagccgggcctt
cagttctactccggcaacttcctggacggcacactggtcggccccggcgggcacatctac
cgccagggcgacgcgctgtgcctggagacccagcacttccccaactcgccgaaccagccg
gcgttcccgtcgacggtgctgcggccgggcgagacctaccgcagctcgacggtgcactcg
ttcgacgcctga

KEGG   Streptomyces avermitilis: SAVERM_5782
Entry
SAVERM_5782       CDS       T00126                                 

Gene name
galM2
Definition
(GenBank) putative aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00052  Galactose metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Module
sma_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_5782 (galM2)
   00052 Galactose metabolism
    SAVERM_5782 (galM2)
Enzymes [BR:sma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SAVERM_5782 (galM2)
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-ProteinID: BAC73494
NITE: SAV5782
UniProt: Q82BC3
Position
complement(6987491..6988471)
AA seq 326 aa
MSELFGTLLDGAAVRRWTLERGGVRVRVLSYGGIVQSAEVPDRDGRTADVVLGFDGLDGY
LAHPEPYFGALVGRYANRIAGGRFSLDGREYRLARNNGPNSLHGGERGFDKRVWEAEPVE
HGVRLSRVSPDGEEGFPGRLEISVTYTLGADAALRIAYEAVTDAPTVVNLTNHSYWNLAG
SGNAGGHALRIAASRLTPVDGNLIPSGAFDDVSGTRFDFRRPRKAGSGYDHNFALDKGVT
RAPEPVAELHDPSSGRVLTVATTEPGLQLYTADHLDASVPFAPGDGIALETQHFPDSPNH
PDFPTTQLRPGEVFRSETVYGFGVRD
NT seq 981 nt   +upstreamnt  +downstreamnt
atgagtgaacttttcggcacacttctcgacggcgcggcggtccgtcggtggacgctggag
cggggcggcgtgcgggtgcgggtcctgtcgtacggcgggatcgtgcagtcggccgaggtt
ccggaccgggacggccgtacggcggacgtggtgctgggcttcgacggtctcgacggctat
ctggcgcatccggagccgtacttcggggcgctggtcgggcggtacgcgaaccggatcgcg
ggcggccgcttctcgctcgacggccgcgagtaccggctggcgcggaacaacgggcccaac
tccctgcacggtggcgagcgcggcttcgacaagcgcgtgtgggaggcggagccggtcgag
cacggcgtacggctgtcccgggtgagcccggacggtgaggagggcttcccgggccgtctg
gagatctccgtgacgtacaccctcggcgcggacgccgcgctgcggatcgcgtacgaggcg
gtcacggacgcgccgacggtggtgaacctgacgaaccactcgtactggaacctggcgggt
tcggggaacgcgggcggtcacgcgctgcggatcgccgcgtcccggctgacgccggtggac
gggaacctcatccccagcggcgcgttcgacgacgtgtccggcacgcgcttcgacttccgg
cggccgcggaaggcgggctcggggtacgaccacaacttcgccctggacaagggggtgacg
cgggctcccgagccggtcgcggaactgcacgatccctcctcgggccgggtcctgaccgtg
gcgaccacggaaccgggcctccagctctacaccgcggaccacctcgacgcgtccgtcccc
ttcgccccgggcgacggcatcgccctggagacccagcacttccccgactccccgaaccac
ccggacttcccgacgacccagctgcgcccgggcgaggtgttccggtcggagacggtgtac
gggttcggggtgcgcgactag

DBGET integrated database retrieval system