KEGG   Streptomyces avermitilis: SAVERM_4623Help
Entry
SAVERM_4623       CDS       T00126                                 

Gene name
holB
Definition
(GenBank) putative DNA polymerase III delta prime subunit
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_4623 (holB)
   03430 Mismatch repair
    SAVERM_4623 (holB)
   03440 Homologous recombination
    SAVERM_4623 (holB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_4623 (holB)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_4623 (holB)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_4623 (holB)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_4623 (holB)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_4623 (holB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 AAA DNApol3-delta_C AAA_22 RuvB_N Mg_chelatase AAA_5 AAA_16
Motif
Other DBs
NCBI-ProteinID: BAC72335
NITE: SAV4623
UniProt: Q82EJ2
Position
5647265..5648470
Genome map
AA seq 401 aa AA seqDB search
MPVWDDLVGQEKLSEQLAAAARDADALVTAATAGTPPPEASKMTHAWLFTGPPGAGRTTA
ARAFAAALQCVSPDRALGGIPGCGFCDGCHTALLGTHADVSTVAAVGTQILADDMRDTVR
KSFTSPANGRWQVILVEDAERLNEKSANAVLKAVEEPAPRTVWLLCAPSVEDVLPTIRSR
CRHLNLLTPSVDAVADMLVRRDGIEPEAAYAAARATQGHVDRARRLATDPRARERRAAVL
KMPLRVEDIGGCLKAAQELVDAATADSKQLAEEVDVKETEEMRAALGGAQGGRMPRGTAG
VMKDLEDKQKRRRTRTQRDSLDLALTELTGFYRDVLALQLGSRLALANTDAEDALERLAR
GSSPEATLRRIDAIAACRDALDRNVAPLLAVEAMTMALRAG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgtgggacgacctggtgggccaggagaagctgagcgagcagctcgccgcggct
gcccgtgacgccgacgccctggtcaccgcggccaccgccggcactccgccgcccgaggcg
tcgaagatgacgcacgcctggctgttcacgggcccgcccggcgcgggccgcaccacggcc
gcgcgtgccttcgccgcggcgctccagtgcgtgagccccgaccgcgcgctgggcggcatc
cccggctgcggcttctgcgacggctgccatacggccctgctcggcacccacgccgacgtc
agcacggtcgccgccgtgggcacgcagatcctcgccgacgacatgcgggacaccgtgcgc
aagtcgttcacgtctccggccaacggacgctggcaggtgatcctcgtggaggacgccgag
cggctgaacgagaagtcggccaacgcggtcctgaaggcagtggaggagcccgccccccgc
acggtctggctgctgtgcgccccctccgtggaggacgtcctgccgacgatccgctcccgc
tgccgccacctgaacctgctcacaccttccgtggacgccgtcgcggacatgctcgtacgc
cgggacggcatcgagccggaggccgcgtacgccgcggcccgcgccacgcagggccatgtc
gaccgtgcccgccgcctggccaccgacccgcgcgcgcgggagcgcagggccgccgtgctg
aaaatgccgttgcgggtcgaggacatcggcggctgcctcaaggcggcccaggagctggtc
gacgccgccacggccgactccaagcagctcgccgaggaagtcgacgtgaaggagaccgag
gagatgagggcggcgctcggcggggcacagggcggtcggatgccgcgcggcaccgcgggc
gtgatgaaggacctggaagacaagcagaagcgccggagaacgcgtacgcagcgcgacagc
ctggacctggccctgaccgagctgacgggcttctatcgcgacgtcctcgccctccagctc
ggctcccgcctggccctcgccaacacggacgccgaggacgccctggagcgcctcgcccgc
ggcagctcaccggaggccacactccgccgcatcgacgcgatcgccgcgtgccgggacgcc
ctggaccgcaatgtggcccctctgctggcggtggaggcgatgacgatggcactgcgggcg
gggtga

DBGET integrated database retrieval system