KEGG   Streptomyces avermitilis: SAVERM_4716Help
Entry
SAVERM_4716       CDS       T00126                                 

Gene name
ilvD1
Definition
(GenBank) putative dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
sma  Streptomyces avermitilis
Pathway
sma00290  Valine, leucine and isoleucine biosynthesis
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sma_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_4716 (ilvD1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_4716 (ilvD1)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     SAVERM_4716 (ilvD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD DUF4154
Motif
Other DBs
NCBI-ProteinID: BAC72428
NITE: SAV4716
UniProt: Q82E99
Position
5746979..5748832
Genome map
AA seq 617 aa AA seqDB search
MPELRSRTVTHGRNMAGARALMRASGVPGADIGRKPIIAVANSFTEFVPGHTHLQPVGRI
VSEAITAAGGIAREFNTIAVDDGIAMGHGGMLYSLPSRDLIADSVEYMVEAHCADALICI
SNCDKITPGMLMAALRLNIPTVFVSGGPMESGRATLVDGTVRTLDLVDAISDAVNDKISD
EDILRIEENACPTCGSCSGMFTANSMNCLTEAIGLSLPGNGSVLATHTARKGLYEDAART
VVDITRRYYEQDDESVLPRNIATHAAFENAMALDIAMGGSTNTILHLLAAAQEAGVPFGL
DEINEVSRRVPCLAKVAPNVAKDRTYYMEDVHRAGGIPALLGELHRAGLLNEDVHSVHSP
SLSDWLKTWDVRAGSPSPEAIELWHAAPGCVRSSEAFSQSERWEALDEDAEGGCIRSAEH
AYSKDGGLAVLKGNLAVDGCVVKTAGVDESIWTFEGPAVVCESQDEAVDKILRKEITHGD
VVVIRYEGPKGGPGMQEMLYPTSFLKGRGLGKTCALITDGRFSGGTSGLSIGHASPEAAS
GGTIALVQDGDRIRIDIPNRTIDLLVDEAELSRRDQALNGVYAPVNRERKVSAALRAYAA
MATSADKGAVRDVSKLG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgaggtcccgcacagtcacccacggtcgcaacatggcgggcgcccgcgcc
cttatgcgcgcctccggtgtaccgggcgcggacatcggccggaagccgatcatcgcggtc
gccaactccttcacggagttcgtgcccggccacacccacctccagccggtcggccggatc
gtcagcgaggccatcacggccgccggcggcatcgcgcgcgagttcaacacgatcgcggtc
gacgacggcatcgcgatgggccacggcggcatgctgtactccctcccgtcccgcgacctg
atcgcggactcggtcgagtacatggtcgaggcccactgcgccgacgccctgatctgcatc
tcgaactgcgacaagatcacgcccggcatgctcatggccgctctgcgcctgaacatcccg
acggtcttcgtctccggcggccccatggagtccggccgcgccaccctggtcgacggcacg
gtccgtacgctcgacctggtcgacgcgatctccgacgccgtgaacgacaagatctcggac
gaggacatcctccgtatcgaggagaacgcctgtcccacctgcggctcctgctccggcatg
ttcaccgccaactcgatgaactgcctgaccgaggccatcggcctgagcctgcccggcaac
ggctcggtcctcgccacgcacacggcccgcaagggtctgtacgaggacgcggcccgcacg
gtcgtggacatcacgcgccgttactacgagcaggacgacgagtcggtcctgccccgcaac
atcgccacgcacgccgccttcgagaacgccatggccctcgacatcgccatgggcggctcc
accaacacgatcctgcacctgctggccgccgcccaggaagcgggcgtccccttcggcctg
gacgagatcaacgaggtctcgcgccgcgtgccctgcctcgccaaggtcgccccgaacgtc
gccaaggaccgtacgtactacatggaggacgtgcaccgcgcgggcggcatcccggccctg
ctgggcgagctgcaccgggccggcctgctgaacgaggacgtgcactcggtgcacagcccg
tccctctccgactggctgaagacgtgggacgtgcgggcgggttccccgtcccccgaggcc
atcgaactgtggcacgcggcccccggctgcgtccgctcctccgaggccttctcccagtcc
gagcgctgggaggcgctcgacgaggacgcggagggcggctgcatccgctccgccgaacac
gcgtactccaaggacggcggcctcgcggtcctcaagggcaacctggcggtcgacggctgc
gtcgtgaagacggcgggcgtcgacgagtcgatctggaccttcgagggcccggcggtcgtc
tgcgagtcgcaggacgaggccgtcgacaagatcctccgcaaggagatcacccacggcgac
gtggtcgtcatccgctacgagggccccaagggcggccccggcatgcaggagatgctctac
ccgacgtcgttcctgaagggccggggcctcggcaagacctgtgccctgatcacggacggc
cgtttctccggcggcacctcgggcctgtcgatcggccacgcctcccccgaggcggcgtcc
ggcggcacgatcgcgctggtccaggacggcgaccgcatccgcatcgacatcccgaaccgc
acgatcgacctcctggtggacgaggccgaactgtcccgccgcgaccaggccctgaacggc
gtctacgcccccgtgaaccgcgagcgcaaggtctccgcggccctgcgcgcgtacgccgcg
atggccacgagcgcggacaagggcgcggtccgggacgtgtcgaagctgggctga

DBGET integrated database retrieval system