KEGG   Streptomyces avermitilis: SAVERM_4724
Entry
SAVERM_4724       CDS       T00126                                 

Gene name
proC
Definition
(GenBank) putative pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Module
sma_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_4724 (proC)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     SAVERM_4724 (proC)
SSDB
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 NAD_Gly3P_dh_N ApbA Shikimate_DH PDH IlvN 2-Hacid_dh_C Rossmann-like TrkA_N NAD_binding_10
Other DBs
NCBI-ProteinID: BAC72436
NITE: SAV4724
UniProt: Q82E92
Position
5756668..5757477
AA seq 269 aa
MTQKVAVLGTGKIGEALLSGMIRAGWAPTDLLVTARRPERAEELRARHGVTPVTNAEAAK
TADTLILTVKPQDMGTLLTELAPHVPTDRLVISGAAGIPTSFLEERLAQGTPVVRVMTNT
PALVDEAMSVISAGSHATAGHLAHAEEIFGAVGKTLRVPESQQDACTALSGSGPAYFFYL
VEAMTDAGILLGLPRDKAHDLIVQSAIGAAIMLRDSGEHPVKLRENVTSPAGTTINAIRE
LENHGVRAALIAALEAARDRSRELASGSS
NT seq 810 nt   +upstreamnt  +downstreamnt
atgacccagaaagtcgcagtcctcggcaccggcaagatcggcgaagccctgctcagcgga
atgatccgagcgggctgggcccccaccgacctcctggtcaccgcccgccgccccgagcgc
gccgaagagctccgcgcgcgccacggcgtcaccccggtcaccaacgcggaggccgccaag
accgccgacaccctgatcctgacggtcaagccgcaggacatgggcaccctcctcaccgag
ctcgcgccgcacgtccccaccgaccgcctggtcatcagcggcgcggcaggcatccccacc
tccttcctggaggagcgcctcgctcagggcacccccgtcgtccgggtcatgacgaacacc
cccgcgctcgtcgacgaggccatgtccgtcatctccgccggcagccacgccaccgccggg
cacctcgcgcacgccgaggagatcttcggcgcggtcggcaagaccctgcgcgtcccggaa
tcccagcaggacgcctgcaccgcactctccggatcgggcccggcgtacttcttctatctg
gtcgaggccatgacggacgcgggcatcctgctgggactgccccgcgacaaggcgcacgat
ctgatcgtccagtccgcgatcggcgccgcgatcatgctccgcgacagcggcgagcacccc
gtcaagctccgcgagaacgtgacgtcaccggccggcacgacgatcaacgcgatccgcgaa
ctggagaaccacggggtacgcgccgcactgatcgccgccctggaggcagcccgcgaccgc
agccgcgaactggcctccggcagcagctga

DBGET integrated database retrieval system