KEGG   Streptomyces avermitilis: SAVERM_4806
Entry
SAVERM_4806       CDS       T00126                                 

Gene name
cdd4
Definition
(GenBank) putative cytidine/deoxycytidine deaminase
  KO
K03365  cytosine/creatinine deaminase [EC:3.5.4.1 3.5.4.21]
Organism
sma  Streptomyces avermitilis
Pathway
sma00240  Pyrimidine metabolism
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAVERM_4806 (cdd4)
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_4806 (cdd4)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.1  cytosine deaminase
     SAVERM_4806 (cdd4)
    3.5.4.21  creatinine deaminase
     SAVERM_4806 (cdd4)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam SNAD4 Bd3614-deam
Other DBs
NCBI-ProteinID: BAC72518
NITE: SAV4806
UniProt: Q82E10
Position
complement(5848403..5848864)
AA seq 153 aa
MDQVMDQAQARAWLATAVEEARAGLAEGGIPIGAALYGADGALLGRGHNRRVQDDDPSMH
AETAAFRSAGRQRTYRGTTMVTTLSPCWYCSGLVRQFGISRVVVGEAATFHGGHDWLAEH
GVEIVLLDDPECTALLRGFIKNNPALWNEDIGE
NT seq 462 nt   +upstreamnt  +downstreamnt
atggatcaggtcatggatcaggcacaggcacgcgcatggctcgccacggccgtcgaggag
gcccgcgccgggctggccgagggcggcatccccatcggcgccgcgctgtacggcgcggac
ggcgccctgctcggccgcggccacaaccgccgcgtccaggacgacgacccgtcgatgcac
gcggagacggcggcgttccgcagcgccggacggcagcggacgtaccgcggtacgacgatg
gtgacgaccctctcgccgtgctggtactgctccggcctggtccgccagttcggcatctcg
cgggtcgtggtgggcgaggcggccaccttccacggcggccacgactggctggcggagcac
ggcgtggagatcgtgctcctcgacgatcccgagtgcaccgccctgctgcgcggcttcatc
aagaacaacccggcactgtggaacgaggacatcggtgagtga

KEGG   Streptomyces avermitilis: SAVERM_4899
Entry
SAVERM_4899       CDS       T00126                                 

Definition
(GenBank) putative hydrolase
  KO
K01485  cytosine/creatinine deaminase [EC:3.5.4.1 3.5.4.21]
Organism
sma  Streptomyces avermitilis
Pathway
sma00240  Pyrimidine metabolism
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAVERM_4899
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_4899
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.1  cytosine deaminase
     SAVERM_4899
    3.5.4.21  creatinine deaminase
     SAVERM_4899
SSDB
Motif
Pfam: Amidohydro_3 Amidohydro_2 Amidohydro_1 EccE
Other DBs
NCBI-ProteinID: BAC72611
NITE: SAV4899
UniProt: Q82DR9
Position
complement(5954988..5956229)
AA seq 413 aa
MPDSRPQPPHSSSGQTDPAGLLLCGARLTDGRTVDVRLGGGRIEAVGTAGSLATDAVGAR
VDLAGYLLLPAPVEPHAHGDTALSADGAGPVSYGAPEVQRRATEAALLQLGHGATALRAH
VHVSDVQGLDALTAVLQARRSLHGLAELSAVAMPRVLTGAAGADGVAMLRDALKMGAAVV
GGCPDADPDPTGYVETVLELAAEQGCPVDLHTDGDDPARLARLAAMAGGLRPGVTLGPCG
GLRRLPAEVAARIADQLAAAGVTVVCLPQGGCGGADRPGTAPVRLLRSAGVRVAAGSGAL
RDVSNPVGRGDPLEAAYLLASRYGLRPEDAYDAVSTAARAALGLPEVRVEAGFPAELLAV
RGDRLAGALSLAYSRIVVHRGRVVARTSAVREYCNSAAAVALDLPRQGRGEPS
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgcccgacagccgaccgcagccgccccactcgtcgtcgggacagaccgacccggccggc
ctcctgctgtgcggagcgcggctcaccgacggacggaccgtggacgtgcggctgggcggc
gggcgtatcgaggcggtcggtaccgccgggagtctggcgacggacgcggtcggcgcgcgc
gtggacctcgccggctatctgctcctgccggcccccgtcgagccgcacgcccacggggac
acggccctgtcggccgacggcgcgggacctgtgtcgtacggcgctccggaggtccagcgc
cgcgcgaccgaggccgcgttgctgcaactcggacacggggcgacggctctgcgcgcccac
gtacacgtgagtgacgtacagggcctggacgcactgacggcggtgcttcaggcacgacgg
tcactgcacgggctcgccgagttgtcggcggtggcgatgccacgggtgctgaccggggcc
gccggggcggacggggtcgcgatgctgcgcgacgcgctgaagatgggcgccgcggtggtg
ggtggctgtccggacgccgacccggatccgacggggtacgtggagacggttctggaactc
gccgccgagcagggctgccccgtcgacctgcacacggacggtgacgatccggcccggctc
gcccggctcgcggcgatggccggcgggctgcgtcccggggtcacgctgggcccttgcggg
gggctgcgccgactgcccgccgaggtcgccgcacgcatcgcggaccaactcgccgcggcc
ggggtgacggtggtgtgcctgccgcagggtggctgcgggggcgccgaccggcccggtacg
gcgcccgtacggctgctgcggtcggccggcgtgcgggtcgcggccggcagcggcgctctg
agggacgtgtcgaacccggtgggccgcggggatccgctggaggccgcgtatctgctggcc
tcgcgctacgggctgcggcccgaggacgcgtacgacgccgtgagcaccgcagcccgggcc
gctctcggcctgcccgaagtacgcgtggaggcgggattcccggccgaactgctcgccgta
cggggcgaccggctggccggggcgctgtcgctcgcgtacagccggatcgtcgtacaccgg
gggcgggtcgtggcgcggaccagcgcggtgcgggagtactgcaactcggcggccgcggtg
gcgctggacctgcctcggcaggggcggggagagccgtcgtga

DBGET integrated database retrieval system