KEGG   Streptomyces avermitilis: SAVERM_4907
Entry
SAVERM_4907       CDS       T00126                                 

Gene name
aspC1
Definition
(GenBank) putative aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00250  Alanine, aspartate and glutamate metabolism
sma00270  Cysteine and methionine metabolism
sma00330  Arginine and proline metabolism
sma00350  Tyrosine metabolism
sma00360  Phenylalanine metabolism
sma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sma00401  Novobiocin biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_4907 (aspC1)
   00270 Cysteine and methionine metabolism
    SAVERM_4907 (aspC1)
   00220 Arginine biosynthesis
    SAVERM_4907 (aspC1)
   00330 Arginine and proline metabolism
    SAVERM_4907 (aspC1)
   00350 Tyrosine metabolism
    SAVERM_4907 (aspC1)
   00360 Phenylalanine metabolism
    SAVERM_4907 (aspC1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAVERM_4907 (aspC1)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SAVERM_4907 (aspC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_4907 (aspC1)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     SAVERM_4907 (aspC1)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class I
   SAVERM_4907 (aspC1)
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase
Other DBs
NCBI-ProteinID: BAC72619
NITE: SAV4907
UniProt: Q82DR2
Position
complement(5963056..5964282)
AA seq 408 aa
MSAATPPTERRVSARVGAISESATLAVDAKAKALKAAGRPVIGFGAGEPDFPTPDYIVQA
AIEACSNPKYHRYTPAGGLPELKAAIAAKTLRDSGYEVDASQVLVTNGGKQAIYEAFAAI
LDPGDEVIVPAPYWTTYPESIRLAGGVPVDVVADETTGYRVSVEQLEAARTENTKVLLFV
SPSNPTGAVYTREQIEEIGRWAAEKGLWVLTDEIYEHLVYGDAEFHSLPVVVPELADKCI
VVNGVAKTYAMTGWRVGWVIGPKDVIKAATNLQSHATSNVSNVAQVAALAAVSGDLTAVA
EMREAFDRRRKTIVRMLNEIGGVLCPEPEGAFYAYPSVKALLGKEIRGKRPQDTVELAAL
ILEEAEVAVVPGEAFGTPGYLRLSYALGDEDLVEGVSRIQKLLSEAKD
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgagcgctgcaacccctcccaccgagcgccgggtctccgcccgagtcggcgcgatctcc
gagtccgccaccctcgccgtggatgccaaggccaaggccctcaaggccgccggacgtccg
gtgatcggcttcggcgccggtgagcccgacttcccgaccccggactacatcgtccaggcc
gccatcgaggcctgctcgaacccgaagtaccaccgctacacgccggccggcggcctgccc
gagctgaaggccgccatcgccgcgaagacgctccgcgactcgggctacgaggtggacgcc
tcgcaggtcctggtcaccaacggcggcaagcaggcgatctacgaggccttcgccgcgatc
ctcgacccgggcgacgaggtcatcgtccccgcgccgtactggaccacctacccggagtcg
atccgtctcgccggcggtgtccccgtcgacgtcgtcgccgacgagaccaccggctaccgc
gtctcggtcgagcagctggaggccgcccgcaccgagaacaccaaggtgctgctcttcgtc
tccccgtccaacccgacgggcgcggtctacacccgcgagcagatcgaggagatcggccgc
tgggccgccgagaagggcctgtgggtcctgaccgacgagatctacgagcacctcgtctac
ggggacgccgagttccactccctgccggtggtcgtgcccgagctggccgacaagtgcatc
gtggtcaacggtgtcgcgaagacgtacgcgatgaccggctggcgcgtgggctgggtcatc
ggtcccaaggacgtcatcaaggccgcgacgaacctccagtcgcacgccacgtcgaacgtc
tccaacgtggcgcaggtcgccgcgctcgccgccgtgtccggcgatctgacggccgtcgcc
gagatgcgcgaggccttcgaccgccgccgcaagaccatcgtgcggatgctgaacgagatc
ggcggcgtcctgtgcccggagcccgagggcgcgttctacgcgtacccctcggtgaaggcg
ctgctcggcaaggagatccgcggcaagcgcccgcaggacacggtcgagctggccgcgctg
atcctggaggaggccgaggtcgcggtcgtccccggcgaggccttcggcacgccgggctat
ctgcggctgtcgtacgccctgggtgacgaggatctggtcgagggcgtcagccggattcag
aagctgctgtccgaggcgaaggactga

DBGET integrated database retrieval system