KEGG   Streptomyces avermitilis: SAVERM_4915
Entry
SAVERM_4915       CDS       T00126                                 

Gene name
rpoC
Definition
(GenBank) RNA polymerase beta prime subunit
  KO
K03046  DNA-directed RNA polymerase subunit beta' [EC:2.7.7.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    SAVERM_4915 (rpoC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sma03021]
    SAVERM_4915 (rpoC)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_4915 (rpoC)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     SAVERM_4915 (rpoC)
Transcription machinery [BR:sma03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     SAVERM_4915 (rpoC)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      SAVERM_4915 (rpoC)
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4
Other DBs
NCBI-ProteinID: BAC72627
NITE: SAV4915
UniProt: Q82DQ4
Position
5973224..5977123
AA seq 1299 aa
MLDVNFFDELRIGLATADDIRQWSHGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWEC
YCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDL
APKDLEKVIYFAAYMITYVDDERRTRDLPSLEAHVSVERQQIENRRDSDLEARAKKLETD
LAELEAEGAKADVRRKVREGAEREMKQLRDRAQREIDRLDEVWTRFKNLKVQDLEGDELL
YRELRDRFGTYFDGSMGAAALQKRLESFDLDEEAERLREIIRTGKGQKKTRALKRLKVVS
AFLQTSNSPKGMVLDCVPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDL
GAPEIIVNNEKRMLQEAVDALFDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGK
RVDYSARSVIVVGPQLKLHQCGLPKAMALELFKPFVMKRLVDLNHAQNIKSAKRMVERGR
TVVYDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQIHPLVCTAFNADFDGDQ
MAVHLPLSAEAQAEARILMLSSNNILKPADGRPVTMPTQDMVLGLFFLTTDGALRNVKGE
ERSFASVAEAIMAFDAGELSLQSRVDIRFPVGTIPPRGWTPPAREEGEPEWQQGDTFRLR
TTLGRALFNELLPEDYPFVDYEVGKKQLSEIVNDLAERYPKVIVAATLDNLKAAGFYWAT
RSGVTVAISDIVVPEAKKEIVKGYEAQDEKVQKQYERGLITKDERTQELIAIWTKATNEV
AEAMNANFPKTNPIFMMVDSGARGNMMQMRQIAGMRGLVSNAKNETIPRPIKASFREGLS
VLEYFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIIREEDCGTERGLKLKIAERG
ADGVLRKTDDVETSVYARMLAEDVVIDGKVIAPANVDLGDVLIDQLVHHGVEEVKTRSIL
TCESQVGTCAMCYGRSLATGKLVDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDIT
QGLPRVVELFEARTPKGVAPISEASGRVRIEETEKTKKIVVTPDDGSDETAFPISKRARV
LVTEGEHVEVGQKLTVGATNPHDVLRILGQRAVQVHLVGEVQKVYNSQGVSIHDKHIEII
IRQMLRRVTIIESGDAELLPGELVERSKFETENRRVVQEGGHPASGRPQLMGITKASLAT
ESWLSAASFQETTRVLTDAAINAKSDSLIGLKENVIIGKLIPAGTGLSRYRNIRVEPTEE
AKAAMYSAVGYDDIDYSPFGTGSGQAVPLEDYDYGPYNQ
NT seq 3900 nt   +upstreamnt  +downstreamnt
gtgctcgacgtcaacttcttcgatgagctccggatcggtctggccaccgctgacgacatc
cgtcagtggagccacggcgaggtcaagaagcccgagaccatcaactaccgcaccctcaag
cccgaaaaggacggactcttctgcgagaagatcttcggtccgacccgggactgggagtgc
tactgcggtaagtacaagcgtgtccgcttcaagggcatcatctgcgagcgctgcggcgtc
gaggtcactcgcgccaaggtgcgtcgtgagcggatgggccacatcgaactggccgctccc
gtcacccacatctggtacttcaagggcgtcccgtcgcgcctcggctacctgctcgacctc
gccccgaaggacctcgagaaggtcatctacttcgcggcgtacatgatcacgtacgtcgac
gacgagcgtcgcacccgcgacctgccctcgctggaggcgcacgtctccgtcgagcgtcag
cagatcgagaaccgccgcgactccgacctcgaggcccgcgccaagaagctcgagaccgac
ctggccgagctggaggccgagggcgccaaggccgacgtgcgccgcaaggtgcgcgagggt
gccgagcgtgagatgaagcagctgcgcgaccgtgcgcagcgcgagatcgaccgtctcgac
gaggtgtggacccgcttcaagaacctcaaggtccaggacctcgagggcgacgagctcctc
taccgcgagctgcgtgaccgcttcggcacgtacttcgacggttcgatgggtgccgcggcg
ctgcagaagcgtctggagtccttcgacctcgacgaggaggccgagcgcctccgcgagatc
atccgtaccggcaagggccagaagaagacccgtgcgctcaagcgcctcaaggtcgtctcc
gcgttcctgcagaccagcaacagccccaagggcatggtgctcgactgcgtgccggtcatc
ccgccggacctgcgtccgatggtgcagctggacggtggccgcttcgcgacctccgacctg
aacgacctgtaccgccgcgtgatcaaccgcaacaaccgcctgaagcggcttctcgacctc
ggcgcgcccgagatcatcgtgaacaacgagaagcgcatgctccaggaggcggtcgacgcc
ctcttcgacaacggccgtcgtggtcgcccggtcacgggccccggcaaccgtccgctgaag
tccctcagcgacatgctgaagggtaagcagggtcgtttccgtcagaacctgctcggtaag
cgtgtggactactccgcgcgttccgtgatcgtcgtcggtccgcagctgaagctgcaccag
tgtggtctgcccaaggccatggcgctggagctcttcaagccgttcgtgatgaagcgcctg
gtcgacctgaaccacgcgcagaacatcaagtcggcgaagcggatggtcgagcgcggccgc
acggtcgtgtacgacgtcctggaagaggtcatcgcggagcacccggttctgctgaaccgt
gcgcccacgctgcaccgcctcggcatccaggccttcgagccgcagctggtcgagggcaag
gccatccagatccacccgctcgtctgcaccgcgttcaacgcggacttcgacggtgaccag
atggccgtgcacctgccgctctccgcggaggcgcaggccgaggcccgcatcctgatgctg
tcctcgaacaacatcctcaagccggccgacggccgcccggtcacgatgccgacccaggac
atggtcctcggtctgttcttcctgaccaccgacggtgcgctgcgcaacgtcaagggcgag
gagcgctccttcgcgtccgtcgccgaggcgatcatggcgttcgacgccggcgagctctcg
ctgcagtcccgcgtggacatccgcttcccggtgggcaccatcccgccgcgcggctggacc
ccgccggcccgcgaggagggcgagccggagtggcagcagggtgacaccttccgcctgcgg
acgaccctgggccgcgcgctcttcaacgagctgctgcccgaggactacccgttcgtcgac
tacgaggtcggcaagaagcagctctccgagatcgtcaacgacctcgccgagcgctacccc
aaggtcatcgtggcggcgacgctcgacaacctgaaggcggccggcttctactgggcgacc
cgctccggcgtcaccgtggccatctccgacatcgtcgttcccgaggcgaagaaggagatc
gtcaagggctacgaggcgcaggacgagaaggtccagaagcagtacgagcgcggtctgatc
accaaggacgagcgcacgcaggaactcatcgcgatctggaccaaggcgaccaacgaggtt
gccgaggcgatgaacgcgaacttcccgaagacgaaccccatcttcatgatggttgactcg
ggtgcccgaggaaacatgatgcagatgcgtcagatcgccggtatgcgtggtctggtgtcg
aacgccaagaacgagacgattccccgtcccatcaaggcgtcgttccgtgagggtctgtcc
gtgctggagtacttcatctccacgcacggtgcccgtaagggtctggcggacaccgccctg
cgtaccgccgactcgggttacctgacccgtcgtctggtggacgtctcgcaggacgtcatc
atccgcgaggaggactgcggcaccgagcgcggtctgaagctgaagatcgccgagcgcggc
gccgacggcgtgctgcgcaagacggacgacgtcgagaccagcgtctacgcccgcatgctc
gccgaggacgtcgtcatcgacggcaaggtgatcgcgccggccaacgtggacctcggcgac
gtgctcatcgaccagctggtgcaccacggtgtcgaggaggtcaagacccgttcgatcctg
acctgtgagtcccaggtcggcacctgcgccatgtgctacggccgttcgctggccaccggc
aagctggtcgacatcggtgaggcggtcggcatcatcgccgcccagtccatcggtgagccc
ggtacccagctgacgatgcgtaccttccacaccggtggtgtggccggtgacgacatcacc
cagggtctgccccgtgtcgtcgagctcttcgaagcccgtacgccgaagggtgtcgccccg
atctccgaggcctccggccgcgtgcggatcgaggagaccgagaagaccaagaagatcgtc
gtcaccccggacgacggcagcgacgagacggcgttcccgatctcgaagcgcgcccgtgtc
ctggtgaccgagggcgagcacgtcgaggtgggccagaagctcaccgtgggtgccaccaac
ccgcacgacgtgctgcgcatcctgggtcagcgtgccgtccaggtccacctggtcggcgag
gtccagaaggtctacaactcgcagggtgtgtcgatccacgacaagcacatcgagatcatc
atccggcagatgctgcgccgggtgacgatcatcgagtcgggcgacgcggagctgctgccc
ggcgagctggtcgagcgctcgaagttcgagaccgagaaccgtcgtgtggtccaggaaggc
ggccacccggcctccggccgtccgcagctgatgggtatcaccaaggcctcgctggcgacc
gagtcgtggctgtcggcggcgtccttccaggagacgaccagggttctgacggacgcggcg
atcaacgccaagtccgactccctgatcggcctcaaggagaacgtcatcatcggtaagctc
atcccggccggtacgggtctgtcccgctaccgcaacatccgggtcgagccgaccgaggag
gccaaggccgcgatgtactcggccgtcggctacgacgacatcgactactcgccgttcggc
acgggctccggccaggccgttccgctggaggactacgactacggtccgtacaaccagtaa

DBGET integrated database retrieval system