KEGG   Streptomyces avermitilis: SAVERM_4946Help
Entry
SAVERM_4946       CDS       T00126                                 

Gene name
secY
Definition
(GenBank) putative preprotein translocase SecY subunit
  KO
K03076  preprotein translocase subunit SecY
Organism
sma  Streptomyces avermitilis
Pathway
sma02024  Quorum sensing
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_4946 (secY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_4946 (secY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_4946 (secY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_4946 (secY)
Secretion system [BR:sma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SAVERM_4946 (secY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecY DUF2976
Motif
Other DBs
NCBI-ProteinID: BAC72658
NITE: SAV4946
UniProt: Q82DM6
Position
5997158..5998474
Genome map
AA seq 438 aa AA seqDB search
MLTAFARAFRTPDLRKKLLFTLAIIVVYRLGTHIPIPGVDYKNVQTCIDSASKGNQGLFG
LVNMFSGGALLQITIFALGIMPYITASIILQLLTVVIPRLEALKKEGQAGTAKITQYTRY
LTVALAILQGTGLVATARSGALFGTCPVGNQIVPDQGIFTTITMVICMTAGTAVVMWLGE
LITDRGIGNGMSILMFISIAASFPSALWAIKQQGSLADGWIEFGTVIAVGLVMVGLVVFV
EQAQRRIPVQYAKRMIGRRSYGGTSTYIPLKVNQAGVIPVIFASSLLYIPALIAQFSKDT
SGWKSWIEQNLTKGDHPIYITAYFLLIVFFAFFYVAISFNPEEVADNMKKYGGFIPGIRA
GRPTAEYLSYVLNRITWPGSLYLGLIALVPTMALVGFGASQNFPFGGTSILIIVGVGLET
VKQIESQLQQRNYEGFLR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaccgcgttcgcccgggcgttcaggacgcccgacctgcgcaagaagctgctcttc
acgctcgcgatcatcgtcgtgtaccgcctcggtacgcacattccgatcccgggcgtcgac
tacaagaacgtccagacctgcatcgactcagcgtcgaagggcaaccagggcctgttcggt
ctggtcaacatgttcagtggtggcgcgctgctgcagatcacgatcttcgcgctcggcatc
atgccgtacatcacggcgagcatcattctgcagctgctgaccgtggtgatcccgcgtctc
gaagccctcaagaaggagggacaggcgggaaccgcgaagatcacgcagtacacccgttat
ctgacggtcgccctggccatccttcagggcaccggcctggtggcgaccgctcgcagcggg
gcgctgttcggcacctgcccggtgggcaaccagatcgtccccgaccaggggatcttcacc
accatcacgatggtcatctgcatgaccgccggtacggctgtcgtgatgtggctcggtgag
ctcatcaccgaccgcggtatcggcaacggcatgtcgatcctgatgttcatctcgatcgcc
gcgagcttcccgtccgcgctgtgggcgatcaagcagcagggctcgctggccgacggctgg
atcgagttcggcaccgtcatcgcggtcggcctggtcatggtcggtctggtggtcttcgtc
gagcaggcccagcgccgtatcccggtgcagtacgcgaagcgcatgatcggccgccggtcc
tacggcggtacgtccacctacatcccgttgaaggtgaaccaggcaggtgtgattcctgtc
atcttcgcgtcgtcgctgctctacattcccgccctgatcgcgcagttctccaaggacacc
tccggctggaagagctggatcgaacagaacctgaccaagggcgaccacccgatttacatc
acggcttacttcctgctgatcgttttcttcgcgttcttctacgtggcgatctcgttcaac
cccgaggaagtcgcggacaacatgaagaagtatggtggcttcatcccgggcatccgggct
ggccgaccgaccgctgagtacctcagctacgtgctcaaccggatcacctggccgggttcg
ctgtatctgggtctgatcgctctcgtaccgacgatggcgttggttggcttcggggcaagc
cagaacttcccgttcggtggtaccagcatcctgatcatcgtgggtgtgggcctcgagacg
gtgaagcagattgagagccagcttcagcagcgcaattacgaagggttcctccgctga

DBGET integrated database retrieval system