KEGG   Streptomyces avermitilis: SAVERM_5075
Entry
SAVERM_5075       CDS       T00126                                 

Gene name
gdhA1
Definition
(GenBank) putative NAD-specific glutamate dehydrogenase
  KO
K15371  glutamate dehydrogenase [EC:1.4.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00250  Alanine, aspartate and glutamate metabolism
sma00430  Taurine and hypotaurine metabolism
sma00910  Nitrogen metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SAVERM_5075 (gdhA1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_5075 (gdhA1)
   00220 Arginine biosynthesis
    SAVERM_5075 (gdhA1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SAVERM_5075 (gdhA1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     SAVERM_5075 (gdhA1)
SSDB
Motif
Pfam: Bac_GDH ELFV_dehydrog HopW1-1 SHS2_Rpb7-N
Other DBs
NCBI-ProteinID: BAC72787
NITE: SAV5075
UniProt: Q82DA7
Position
6152169..6157106
AA seq 1645 aa
MQTKLDEAKAELLERAARVAENSPVGGHLPTGTTGDGIPDRDTVLAFLRRYYLHTAPEDL
ADRDPVDVFGAAFSHYRLAENRPQGTANVRVHTPTVEENGWTCSHSVVEVVTDDMPFLVD
SVTNELSRQGRGIHVVIHPQVVVRRDLTGKLIDVLAPPPAGELPHDAALESWIHVEIDRE
TDRADLKQITADLLRVLSDVREAVEDWEKMRDAALRMAEELPKEPTADDLRDQEVEEARE
LLRWLSADHFTFLGYREYELRGDDSLAAVPGTGLGILRSDPHHAGDDSHPVSPSFERLPA
DARAKAREHKLLILTKANSRSTVHRPSYLDYVGVKKFDENGEVIGERRFLGLFSSAAYTE
SVRRVPVIRRKVEEVLKGAGFSPNSHDGRDLLQILETYPRDELFQTPVDELRSIVTSVLY
LQERRRLRLYLRQDEYGRYYSALVYLPRDRYTTGVRLRIIDILKEELGGTSVDFTAWNTE
SILSRLHFVVRVPQGTELPQLSDADKERIEARLVEAARSWADAFAEALNAECGEERAAEL
LRRYGNAFPEGYKADHTPRAAVADLVHLQKLTSDQSKDFALSLYEPVGASPSERRFKIYR
TGEQVSLSAVLPALNRMGVEVTDERPYELRCSDRTTAWIYDFGLRLPKSASGNGDSLGDD
GRERFQEAFAATWTGEAEIDGFNALVLSAGLNWRQAMVLRAYAKYLRQAGSTFSQDYMED
TLRNNVHTTRLLVSLFEARMSPDRQRAGVELTDALLEELDAALDQVASLDEDRILRSFLT
VIKATLRTNFFQEALGGKPHEYVSMKFDPQAIPDLPAPRPAYEIWVYSPRVEGVHLRFGK
VARGGLRWSDRREDFRTEILGLVKAQMVKNTVIVPVGAKGGFVAKQLPDPSVDRDAWLAE
GIRSYQTFISALLDITDNLVAGEVVPPADVVRHDEDDTYLVVAADKGTATFSDIANEVAE
SYNFWLGDAFASGGSAGYDHKKMGITARGAWESVKRHFRELGVNTQTEDFTVVGVGDMSG
DVFGNGMLLSEHIRLVAAFDHRHIFIDPKPDAATSYAERRRLFELPRSSWADYNTELLSG
GGGIFPRTAKAIPVNAHIREALGIEAGITKMTPADLMKAILKAPVDLLWNGGIGTYVKAS
TESHADVGDKANDAIRVDGADLRVDVVGEGGNLGLTQLGRIEFARSGGRINTDAIDNSAG
VDTSDHEVNIKILLNALVTEGDLTVKQRNKVLAEMTDEVGHLVLRNNYAQNVAIANALAQ
SPDMLHAQQRFMRHLVREKHLDRALEFLPSDRQIRERLNASQGLTGPETAVLLAYTKITV
SDELLGTSLPDDPYLQSLLHAYFPTALRTKFREQIDTHALRREIVTTVLVNDTVNTGGTS
FLHRLREETGASLEEIVRAQTAARAIFESSAVWDAVEALDSQVDADVQTRIRLHSRRLVE
RGTRWLLNNRPQPLQLTETIAFFKDGVKQVWDELPKLLRGADQEWWQKIYDELTAAGVPD
ELATRVAGFSSAFPALDIVSVADRMGKNPMAVAEVYYDLGDRLSITQLMDRIIELPRSDR
WQSMARAAIREDLYAAHASLTADVLAVGNGTSTPEQRFKAWEEKNAAILGRARTTLEEIQ
GSDAFDLANLSVAMRTMRTLLRTHS
NT seq 4938 nt   +upstreamnt  +downstreamnt
atgcagaccaagctggacgaagcaaaggccgagctgctcgagagggctgctcgcgtagct
gagaacagtccggtcggggggcacctaccgactggaacgacgggcgacggaatcccggac
cgggacaccgtgctcgcgttcctccggcgctactacctgcacaccgccccggaggacctt
gccgaccgcgacccggtcgatgtcttcggagccgccttctcgcactacaggctggccgag
aaccgcccacagggcacggccaacgtgcgggtccacacgccgaccgtcgaggagaacggc
tggacgtgcagccactccgtcgtcgaggtcgtgaccgacgacatgcccttcctcgtcgac
tcggtcaccaacgagctgtcgcggcaggggcgcggcatccacgtcgtcatccacccccag
gtcgtcgtacgccgcgacctcaccggcaagctgatcgacgtcctcgccccgccgcccgcc
ggggagctgccgcacgacgcggcgctcgagtcctggatccatgtcgagatcgaccgcgag
accgaccgcgccgatctgaagcagatcaccgccgacctgctgcgcgtcctgtccgacgtt
cgtgaggccgtcgaggactgggagaagatgcgcgacgcggcgctgcgcatggccgaggag
ctgcccaaggagccgaccgccgacgacctgcgtgaccaggaggtcgaagaggcccgcgag
ctgctgcgctggctgtcggccgaccacttcaccttcctcggctaccgcgagtacgagctg
cggggcgacgactcgctggccgccgtacccggcaccgggctcggcatcctgcgctccgac
ccgcaccacgccggtgacgacagccaccccgtgagcccctccttcgagcggctgcccgcc
gacgcccgcgccaaggcccgcgagcacaagctgctcatcctcaccaaggccaacagccgg
tcgaccgtgcaccgcccgtcctacctcgactacgtcggcgtgaagaagttcgacgagaac
ggcgaggtcatcggggagcggcggttcctcggactgttctcgtccgccgcctacaccgag
tccgtgcggcgcgtgccggtcatccggcgcaaggtcgaggaggtcctcaagggggccggc
ttctcgcccaacagccacgacggccgcgacctgctccagatcctggagacctacccgcgc
gacgagctgttccagacgcccgtggacgagctgcgttccatcgtcacctccgtgctgtac
ctccaggagcgtcggcggctgcggctctacctgcgccaggacgagtacgggcgctactac
tcggccctcgtctacctgccccgcgaccgctacaccaccggcgtgcgcctgcggatcatc
gacatcctcaaggaggagctcggcggcaccagcgtcgacttcacggcctggaacaccgag
tcgatcctgtcccggctgcacttcgtggtccgggtcccgcagggcaccgagctgccgcag
ctgtccgacgccgacaaggagcgcatcgaggcgcggctcgtggaggccgcccgttcctgg
gccgacgccttcgccgaggcactgaacgcggagtgcggcgaggagcgcgccgccgagctg
ctgcgtcgctacggcaacgccttccccgagggctacaaggccgaccacacgccgcgcgcc
gccgtcgccgacctggtgcacctgcaaaagctcacgagcgaccagagcaaagacttcgcg
ctcagcctgtacgagccggtgggcgcctcgccctccgagcgccgcttcaagatctaccgc
acgggtgagcaggtctcgctgtccgcggtcctgcccgcactcaaccggatgggcgtcgag
gtcaccgacgagcgcccgtacgagctgcgctgctcggaccgtacgaccgcctggatctac
gacttcgggctgcgtctgcccaagtccgcgagcggcaacggggactccctcggcgacgac
ggccgtgagcggttccaggaggcgttcgccgccacctggaccggcgaggccgagatcgac
ggcttcaacgccctcgtcctgagcgccgggctcaactggcggcaggcgatggtgctgcgc
gcgtacgccaagtacctgcgccaggccggttccaccttcagccaggactacatggaggac
accctccgtaacaacgtccacaccacccggctgctggtgagcctcttcgaggcgcggatg
tccccggaccgccagcgggccggcgtcgagctgaccgacgccctgctggaggagctggac
gccgccctcgaccaggtcgcctcgctggacgaggaccggatcctgcggtccttcctcacg
gtgatcaaggcgaccctgcggaccaacttcttccaggaggcgctcggcggcaagccgcac
gaatacgtctccatgaagttcgacccgcaggccatcccggacctcccggcgccgcgtccg
gcgtacgagatctgggtgtactcgccgcgcgtcgagggtgtgcacctcaggttcggcaag
gtcgcgcgcggtggtctgcgctggtccgaccggcgtgaggacttccgcaccgagatcctc
ggcctggtcaaggcgcagatggtgaagaacaccgtcatcgtgccggtcggcgcgaagggc
ggcttcgtcgccaagcagctgcccgatccgtccgtggaccgggacgcgtggctcgcggag
ggcatccgcagctaccagaccttcatctccgcactgctcgacatcacggacaacctggtc
gccggcgaggtcgtgcccccggcggacgtcgtacggcacgacgaggacgacacctacctc
gtggtcgccgcagacaagggcacggcgacgttctcggacatcgccaacgaggtcgccgag
tcgtacaacttctggctcggggacgccttcgcctccggcggctcggcggggtacgaccac
aagaagatgggcatcacggcgcgcggtgcctgggagtccgtgaagcggcacttccgggag
ctgggcgtgaacacccagaccgaggacttcacggtcgtcggcgtgggcgacatgtccggt
gacgtgttcggcaacggcatgctgctgtccgagcacatccggctggtggcggccttcgac
caccggcacatcttcatcgacccgaagccggacgcggcgacgtcgtacgccgagcggcgc
cggctgttcgagctgccgcgctcgtcgtgggccgactacaacaccgagctgctgtcgggc
gggggcgggatcttcccccgtaccgcgaaggcgatcccggtcaacgcgcacatccgtgag
gccctcggcatcgaggccggcatcaccaagatgaccccggccgacctgatgaaggcgatc
ctcaaggcgccggtcgacctgctgtggaacggcggcatcggcacatacgtcaaggcgagc
acggagtcgcacgcggacgtcggcgacaaggccaacgacgccatccgcgtggacggcgcc
gacctgcgcgtcgacgtcgtcggcgagggcggcaacctcggactgacccagctcggccgg
atcgagttcgcgcgcagcggcgggcggatcaacaccgacgccatcgacaacagcgcgggc
gtggacacctccgaccacgaggtgaacatcaagatcctgctcaacgccctggtcacggag
ggcgacctcaccgtcaagcagcgcaacaaggtgctcgccgagatgaccgacgaggtcggc
cacctggtgctgcgcaacaactacgcgcagaacgtggcgatcgccaacgcgctcgcccag
tccccggacatgctccacgcccagcagcgcttcatgcgtcacctggtgcgcgagaagcac
ctcgaccgggccctggagttcctgcccagcgaccggcagatccgtgagcggctgaacgcg
agccagggcctgaccggtccggagacggccgtcctgctcgcgtacacgaagatcacggtc
tccgacgagctgctcggcacctcgctgcccgacgacccgtatctgcagagcctgctgcac
gcgtacttcccgacggcgctgcgcacgaagttccgcgagcagatcgacacgcacgcgctg
cgccgcgagatcgtgacgaccgtcctggtcaacgacacggtcaacacgggcggtacgagc
ttcctgcaccggctgcgggaggagaccggcgcctcgctggaggagatcgtcagggcgcag
accgcggcccgtgcgatcttcgagtcgagcgcggtgtgggacgcggtcgaggcgctcgac
agccaggtcgacgcggacgtccagacccggatccgcctgcactcgcgtcgcctcgtcgag
cgcggtacgcgctggctgctcaacaaccggccgcagccgctccagctcaccgagacgatc
gcgttcttcaaggacggggtcaagcaggtctgggacgagctgcccaagctgctgcgcggc
gcggaccaggagtggtggcagaagatctacgacgagctgacggcggccggcgtgccggac
gagctcgccacgcgcgtggccggcttctcctccgccttcccggcgctcgacatcgtctcg
gtggccgaccgcatgggcaagaacccgatggccgtcgccgaggtgtactacgacctcggc
gaccgtctgagcatcacccagctcatggaccgcatcatcgaactgccgcgctccgaccgc
tggcagtccatggcccgcgcggcgatccgcgaggacctgtacgcggcccacgcgtcgctc
accgccgacgtcctggcggtcggcaacggcacctccacgcccgagcagcgcttcaaggcg
tgggaggagaagaacgcggcgatcctgggccgcgcgcggacgacgctggaggagatccag
ggctcggacgcgttcgacctggcgaacctgtcggtggcgatgcggacgatgcggacgctg
ctgcggacgcattcgtag

DBGET integrated database retrieval system