KEGG   Streptomyces avermitilis: SAVERM_5172Help
Entry
SAVERM_5172       CDS       T00126                                 

Definition
(GenBank) putative nucleoside-triphosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
sma  Streptomyces avermitilis
Pathway
sma00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_5172
Enzymes [BR:sma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     SAVERM_5172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: BAC72884
NITE: SAV5172
UniProt: Q82D15
Position
6278382..6278984
Genome map
AA seq 200 aa AA seqDB search
MTRLILATRNAGKITELRAILADAGLTHDLVGADAYPDIPDVKETGVTFAENALLKAHAL
ARATGLPAVADDSGLCVDVLGGAPGIFSARWSGRHGDDRANLDLLLAQLSDISEAHRGAH
FACAAALALPDGTERVVEGQLRGTLRHTPTGTNGFGYDPVLQPEGETRTCAELSAEEKNA
ISHRGKAFRELVPVVRELLG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtctgatcctcgccacccgcaacgccggaaagatcaccgaactgagggcgatc
ctcgccgacgccggtctcacccacgacctcgtcggcgcggacgcgtaccccgacatcccc
gacgtcaaggaaacgggcgtcacgttcgcggagaacgccctcctgaaggcgcacgccctc
gcccgggccaccggactcccggcggtcgccgacgactcgggcctgtgcgtggatgtcctg
ggcggcgcccccggcatcttctcggcccgctggtccggccgccacggcgacgaccgggcc
aacctggacctgctcctggcccagctgtccgacatctccgaggcgcacaggggcgcccac
ttcgcgtgcgcggcggccctggccctgccggacgggaccgagcgcgtggtcgagggccaa
ctgaggggcacgctccgccacaccccgacgggcacgaacggcttcggctacgacccggtc
ctccagccggagggcgagacgcgcacctgcgcggagctgtcggcggaggagaagaacgcg
atcagccaccgcggcaaggcgttccgggagttggtgccggtggtgcgggagttgttgggc
tga

DBGET integrated database retrieval system