KEGG   Streptomyces avermitilis: SAVERM_5275
Entry
SAVERM_5275       CDS       T00126                                 

Gene name
fadE4
Definition
(GenBank) putative acyl-CoA dehydrogenase
  KO
K11410  short/branched chain acyl-CoA dehydrogenase [EC:1.3.99.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma00280  Valine, leucine and isoleucine degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_5275 (fadE4)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.12  2-methylacyl-CoA dehydrogenase
     SAVERM_5275 (fadE4)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Other DBs
NCBI-ProteinID: BAC72987
NITE: SAV5275
UniProt: Q79Z42
Position
complement(6390485..6391645)
AA seq 386 aa
MDHRLTPELEELRRTVEEFAHDVVAPKIGDFYERHEFPYEIVREMGRMGLFGLPFPEEYG
GMGGDYLALGIALEELARVDSSVAITLEAGVSLGAMPIHLFGTDAQKAEWLPRLCSGEIL
GAFGLTEPDGGSDAGATRTTARLDESTNEWVINGTKCFITNSGTDITGLVTVTAVTGRKP
DGKPLISSIIVPSGTPGFTVAAPYSKVGWNASDTRELSFADVRVPAANLLGEQGRGYAQF
LRILDEGRIAISALATGLAQGCVDESVKYAGERHAFGRNIGAYQAIQFKIADMEMKAHMA
RVGWRDAASRLVAGEPFKKEAAIAKLYSSTVAVDNAREATQIHGGYGFMNEYPVARMWRD
SKILEIGEGTSEVQRMLIARELGLVG
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggaccaccgtctcacccccgagctggaagaactccgccgcacggtcgaggagttcgcg
cacgacgtcgtcgcccccaagatcggcgacttctacgagcggcacgagttcccgtacgag
atcgtccgcgagatgggccgcatgggcctgttcgggctgccgttcccggaggagtacggc
ggcatgggcggcgactatctggcgctcggcatcgccctcgaagaactcgcccgcgtcgac
tcctccgtcgccatcaccctggaggccggggtctcactgggcgcgatgccgatccacctc
ttcgggacggacgcgcagaaggcggagtggctcccccggctgtgttccggcgagatcctc
ggcgccttcggtctcaccgagccggacggcggctcggacgcgggcgcgacgcgcacgacg
gcccgcctggacgagtcgacgaacgaatgggtgatcaacggcaccaagtgcttcatcacc
aactcgggcaccgacatcacggggttggtgacggtcacggcggtcaccggccggaagccc
gacgggaaaccgctgatctcctcgatcatcgtcccgtccggcacgcccggcttcacggtc
gccgccccgtactcgaaggtcggctggaacgcctcggacacccgcgagctgtccttcgcc
gacgtccgcgtcccggccgcgaacctgctgggcgaacagggccgcgggtacgcgcagttc
ctgcggatcctcgacgagggacggatcgccatctcggccctggccaccgggctcgcccag
ggctgcgtggacgagtcggtgaagtacgccggggaacggcacgcgttcgggcggaacatc
ggggcgtaccaggccatccagttcaagatcgccgatatggagatgaaggcgcacatggcc
cgcgtcggctggcgtgacgccgcgtcccgcctggtcgccggcgagcccttcaagaaggag
gcggcgatcgccaagctctactcgtccacggtcgccgtcgacaacgcccgcgaggccacc
cagatccacggcggctacggcttcatgaacgagtacccggtggcccggatgtggcgcgac
tccaagatcctggagatcggcgagggcaccagcgaggtgcagcggatgctgatcgcaagg
gagttggggctcgtgggctga

DBGET integrated database retrieval system