KEGG   Streptomyces avermitilis: SAVERM_5276Help
Entry
SAVERM_5276       CDS       T00126                                 

Gene name
hmgL
Definition
(GenBank) putative hydroxymethylglutaryl-CoA lyase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00072  Synthesis and degradation of ketone bodies
sma00280  Valine, leucine and isoleucine degradation
sma00281  Geraniol degradation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_5276 (hmgL)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SAVERM_5276 (hmgL)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_5276 (hmgL)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SAVERM_5276 (hmgL)
Enzymes [BR:sma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     SAVERM_5276 (hmgL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: BAC72988
NITE: SAV5276
UniProt: Q82CR7
Position
complement(6391651..6392598)
Genome map
AA seq 315 aa AA seqDB search
MSTPESGLPMVVPAQDLPARVRIHEVGARDGLQNEKGTVPTEVKAEFIRRLADAGLTTIE
ATSFVHPKWVPQLADAEQLFPLVSDLPVALPVLVPNERGLDRALVLGARQVAVFASATES
FAKANLNRTVDEALAMFEPVVTRAKAADVRVRGYLSMCFGDPWEGAVPIHQVVRVCKSLL
DMGCDELSLGDTIGVATPGHVQDLLAELTEEGVPTRAIGVHFHDTYGQALANTLAALQHG
VTTVDASAGGLGGCPYARSATGNLATEDLVWMLQGLGIDTGVDLARLTATSVWMAERLGR
PSPSRTVRALSHKEQ
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccccgagtcgggcctccccatggtcgtaccggcccaggacctccccgcccgc
gtccgcatccacgaggtcggcgcgcgcgacggcctccagaacgagaaggggacggtcccg
acggaggtcaaggcggagttcatccgccgcctcgccgacgcggggctgaccaccatcgag
gccaccagcttcgtccacccgaagtgggtgccccaactcgccgacgcggagcagctgttc
ccgctcgtgagcgacctccccgtggcgctcccggtcctggtgccgaacgaacgcgggctg
gaccgcgcactggtcctgggcgcccgtcaggtcgccgtcttcgccagcgccaccgagtcc
ttcgcgaaggccaacctcaaccgcacggtggacgaggcgctggccatgttcgagccggtg
gtcacccgtgcgaaggccgcggacgtgcgggtgcgcggttacctctccatgtgcttcggc
gacccctgggagggcgcggtcccgatccaccaggtcgtgcgggtctgcaagtccctcctg
gacatgggctgcgacgagctgagcctcggcgacacgatcggggtcgccacccccggccat
gtccaggacctcctcgccgaactgaccgaggagggcgtgccgacccgtgcgatcggcgtg
cacttccacgacacctacggccaggcgctcgccaacaccctcgccgcgctccagcacggc
gtcacgaccgtcgacgcctccgcgggcggcctcggcggctgcccgtacgccaggtccgcg
accggaaacctcgccaccgaagacctcgtgtggatgcttcagggcctcggtatcgacacc
ggagtcgacctcgcccgtctcaccgccacgagcgtgtggatggccgagcgactgggccgg
cccagcccctcccgcaccgtccgcgccctctcccacaaggagcaatga

DBGET integrated database retrieval system