KEGG   Streptomyces avermitilis: SAVERM_5278
Entry
SAVERM_5278       CDS       T00126                                 

Gene name
accD1
Definition
(GenBank) putative acetyl/propionyl CoA carboxylase, beta subunit
  KO
K01969  3-methylcrotonyl-CoA carboxylase beta subunit [EC:6.4.1.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00280  Valine, leucine and isoleucine degradation
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_5278 (accD1)
Enzymes [BR:sma01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.4  methylcrotonoyl-CoA carboxylase
     SAVERM_5278 (accD1)
SSDB
Motif
Pfam: Carboxyl_trans MdcE
Other DBs
NCBI-ProteinID: BAC72990
NITE: SAV5278
UniProt: Q82CR5
Position
complement(6394706..6396337)
AA seq 543 aa
MQEAPELTSAADPASEAWRANEAAHRTLGEELRAKLAAARLGGGERARARHTARGKLLPR
DRVDTLLDPGSPFLELAPLAADGMYEGQAPAAGVVAGIGRVGGRECLVVANDATVKGGTY
YPMTVKKHLRAQEVALENRLPCVYLVDSGGAFLPMQDEVFPDREHFGRIFYNQARMSGAG
IPQIAAVLGSCTAGGAYVPAMSDEAVIVRGQGTIFLGGPPLVKAATGEVVTAEELGGGEV
HARVSGVTDHLAEDDAHALRIVRNIVSTLPARGPLPWAVEPSVEPKVDPYGLYGAVPVDS
RTPYDVREVIARVVDGSRFAEFKAEFGQTLVTGFARIHGHPVGIVANNGILFSESAQKGA
HFIELCDQRGIPLVFLQNISGFMVGRQYEAGGIAKHGAKMVTAVACTRVPKLTVVIGGSY
GAGNYSMCGRAYSPRFLWMWPGAKISVMGGEQAASVLATVKRDQLEARGESWPVDDEEAF
KDPIRAQYEQQGSAYYATARLWDDGVIDPLETRQVLGLALTACANAPLPQKDYTAPGFGV
FRM
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgcaagaggcaccggagctgacgagcgcggcagaccccgcgtcggaggcctggcgggcc
aacgaggcggcgcaccgcacgctgggcgaggagctgcgcgccaagctggcggcggcccgg
ctgggcggcggcgagcgggcacgggcgcggcacaccgcgcgcggcaagctgctgccccgg
gaccgcgtggacacgctgctggaccccggatcaccgttcctggagctggccccgctggcg
gccgacgggatgtacgaggggcaggccccggccgcgggggtggtcgccgggatcggccgg
gtcggcggccgcgagtgcctggtcgtcgccaatgacgccaccgtcaagggcggcacgtac
tacccgatgaccgtgaagaagcacctgcgcgcccaggaggtggccctcgagaaccgcctc
ccgtgcgtgtatctcgtcgactccggaggcgccttcctgcccatgcaggacgaggtcttc
ccggaccgcgagcacttcgggcggatcttctacaaccaggcacggatgtcgggcgccggc
atcccccagatcgcggccgtcctcgggtcctgcacggcgggcggcgcgtatgtgcccgcg
atgagcgacgaggccgtgatcgtgcggggccagggcacgatcttcctgggcggcccgccc
ctggtgaaggcggccaccggcgaggtggtgacggccgaggagctgggcggcggcgaggtc
cacgcgcgcgtgtcgggcgtgacggaccatctggcggaggacgacgcgcacgcgctgcgg
atcgtgcggaacatcgtctccaccctgccggcgcggggcccgctgccctgggcggtcgag
ccgtccgtcgagccgaaggtggatccgtacgggctgtacggcgcggtgccggtcgactcc
cgcaccccctacgacgtccgtgaggtcatcgcgcgcgtggtggacggttcgcgcttcgcc
gagttcaaggcggagttcgggcagaccctggtcaccgggttcgcgcggatccacggccac
ccggtcggcatcgtcgccaacaacggcatcctgttctccgagtcggcccagaagggcgcc
cacttcatcgagctgtgcgaccagcgcggcatcccgctggtgttcctccagaacatctcg
ggcttcatggtcggccggcagtacgaggcggggggcatcgccaagcacggcgccaagatg
gtcacggccgtcgcctgcacccgcgtgccgaagctgaccgtggtgatcggcgggtcgtac
ggcgcgggcaactactcgatgtgcggccgggcgtactcgccgcgcttcctgtggatgtgg
cccggcgccaagatctccgtgatgggcggcgagcaggccgcgtcggtcctcgcgaccgtc
aagcgcgaccagttggaggcgcgcggcgagtcctggcccgtcgacgacgaggaggccttc
aaggacccgatccgcgcccagtacgagcagcagggcagcgcctactacgcgacggcccgc
ctctgggacgacggcgtgatcgacccgctggagacccggcaggtactgggcctcgccctg
accgcgtgcgccaacgcgccgcttccccaaaaggactacacagcgcccggcttcggcgtc
ttccggatgtga

DBGET integrated database retrieval system