KEGG   Streptomyces avermitilis: SAVERM_5342
Entry
SAVERM_5342       CDS       T00126                                 

Gene name
iolA
Definition
(GenBank) putative methylmalonic acid semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
sma  Streptomyces avermitilis
Pathway
sma00280  Valine, leucine and isoleucine degradation
sma00410  beta-Alanine metabolism
sma00562  Inositol phosphate metabolism
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
sma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_5342 (iolA)
   00562 Inositol phosphate metabolism
    SAVERM_5342 (iolA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_5342 (iolA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_5342 (iolA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     SAVERM_5342 (iolA)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     SAVERM_5342 (iolA)
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-ProteinID: BAC73054
NITE: SAV5342
UniProt: Q82CK3
Position
6474502..6476004
AA seq 500 aa
MTKIVNHWIGGKTVEGASGTYGPVTDPATGAVTTKVAFATVDEVDAAVAAAKDAYATWGQ
SSLAKRSTILFKFRALLDANRDAIAELITAEHGKVHSDALGEVARGLEIVDLACGITVQL
KGELSTEVASRVDVSSIRQPLGVVAGITPFNFPAMVPMWMFPLAIACGNTFVLKPSEKDP
SAALKLAELLAEAGLPDGVFNVVHGDKVAVDRLLEHPDVKAVSFVGSTPIARYIHTTASA
KGKRVQALGGAKNHMLVLPDADLDAAADAAVSAAYGSAGERCMAISAVVAVGAIGDELVE
KIRERAEKIKIGPGNDPASEMGPLITKAHRDKVASYVAGAAAQGSEVVLDGTGHTVDGFE
DGHWIGLSLLDKVPTSADAYRDEIFGPVLCVLRVDSYEEGLALINDSPFGNGTAIFTRDG
GAARRFQLEVEAGMVGVNVPIPVPVGYHSFGGWKDSLFGDHHIYGNDGTHFYTRGKVVTT
RWPDPSEAPAGVDLGFPRNH
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgacgaagatcgtcaaccactggatcggcggcaagaccgtcgaaggcgcgtcgggcacg
tacgggccggtcaccgacccggcgaccggcgcggtcaccacgaaggtcgccttcgcgacg
gtcgacgaggtggacgccgcggtcgccgccgcgaaggacgcctacgcgacctggggccag
tcctcgctggccaagcggagcacgatcctcttcaagttccgggcgctgctcgacgccaac
cgggacgcgatcgccgagctgatcaccgcagagcacggcaaggtgcactccgacgcgctc
ggcgaggtcgcgcgcgggctggagatcgtcgacctggcgtgcggcatcaccgtgcagctg
aagggcgagctgtcgaccgaggtcgccagccgggtggacgtctcgtcgatccggcagccg
ctgggtgtcgtcgcgggcatcacgccgttcaacttcccggccatggtgccgatgtggatg
ttcccgctcgccatcgcgtgcggcaacacgttcgtgctgaagccgtccgagaaggacccg
tcggcggccctgaagctggccgagctgctggccgaggccggtctgccggacggcgtcttc
aacgtcgtacacggggacaaggtcgcggtcgaccgcctcctggagcacccggacgtcaag
gcggtgtccttcgtcggctcgacgccgatcgcccgctacatccacacgaccgcctccgcg
aagggcaagcgtgtccaggcgctcggcggcgccaagaaccacatgctggtcctcccggac
gcggacctggacgcggccgccgacgccgccgtctcggccgcgtacggctcggccggcgag
cgctgcatggcgatctccgcggtcgtcgcggtgggcgccatcggggacgagctggtggag
aagatccgcgagcgcgccgagaagatcaagatcggtccgggcaacgacccggcctccgag
atgggtccgctgatcaccaaggcgcaccgcgacaaggtggcctcgtatgtggcgggcgcg
gcggcgcagggctccgaggtcgtcctcgacggcacgggccacacggtcgacggcttcgag
gacggccactggatcggcctctcgctgctcgataaggtgccgacgtccgcggacgcgtac
cgggacgagatcttcggcccggtgctgtgcgtgctgcgcgtggactcgtacgaggagggc
ctcgccctcatcaacgactcgccgttcggcaacggcaccgcgatcttcacccgggacggc
ggcgccgcccgccgcttccagctggaggtcgaggcgggcatggtcggtgtgaacgtgccg
attccggtgccggtgggctaccactccttcgggggctggaaggactcgctcttcggcgac
caccacatctacggcaacgacggcacgcacttctacacccgcggcaaggtcgtcaccacc
cgctggccggacccgtccgaggccccggcgggcgtcgacctgggcttcccgcgcaaccac
tga

DBGET integrated database retrieval system