KEGG   Streptomyces avermitilis: SAVERM_5471
Entry
SAVERM_5471       CDS       T00126                                 

Gene name
proB
Definition
(GenBank) putative glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma00332  Carbapenem biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Module
sma_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_5471 (proB)
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SAVERM_5471 (proB)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SAVERM_5471 (proB)
SSDB
Motif
Pfam: AA_kinase PUA PUA_3
Other DBs
NCBI-ProteinID: BAC73183
NITE: SAV5471
UniProt: Q82C83
Position
6642604..6643731
AA seq 375 aa
MSAARQGVAQARRIVVKVGSSSLTTAAGGLDADRVDALVDVLAKSRSGGEKEIVLVSSGA
IAAGLAPLGLRRRPKDLARQQAAASVGQGLLVARYTASCARHGIRVGQVLLTSDDTSRRA
HHRNASRTLDKLLAMGALPVVNENDTVATDEIRFGDNDRLAALVAHLVRADLLVLLSDVD
GVYDGDPSKPGTSRVAQVHGPQDLAHVEIGSAGRAGVGTGGMVTKIEAARIAAAAGIPVV
LTSAVHAADALAGRDTGTYFHPTGKRSADRLLWLQHASTPQGALTLDDGAVRAVVERRKS
LLPAGIAAVEGEFTAGDPVELRDSEGRAVARGLVSFDAKEIPQLLGRSTRELARELGPAY
EREVVHRDDLVLLQP
NT seq 1128 nt   +upstreamnt  +downstreamnt
gtgtcagcggcaaggcagggtgtggctcaggcccgcaggatcgtcgtcaaagtgggctcc
tcgtccctgaccaccgccgcgggcggactggacgccgaccgggtcgacgccctcgtggac
gtactcgccaagagccgcagcggcggcgagaaggagatcgtcctcgtctcctccggagcc
atcgccgccggtctggcgcccctggggctgcgcaggcgccccaaggacctggcccggcag
caggcggccgcaagcgttggccaaggccttctggtggcccgctacaccgcttcctgcgcc
cgccacggcatccgcgtcggtcaggtgctgctcacctccgacgacaccagccgccgcgcg
caccaccgcaacgcctcccgcaccctcgacaagctcctcgcgatgggcgccctgccggtc
gtgaacgagaacgacacggtcgccacggacgagatccgcttcggcgacaacgaccggctc
gccgccctcgtcgcccacctcgtacgagcggacctgctggtcctgctgtccgacgtggac
ggcgtgtacgacggcgatcccagcaagcccggtacgtcgcgggtggcgcaggtgcacggc
ccgcaggacctcgcgcacgtggagatcggcagcgcgggccgggccggggtcggcaccggc
ggcatggtcaccaagatcgaggcggcccggatcgccgccgcggccggcatccccgtggtg
ctgaccagcgcggtccatgccgccgacgccctcgcgggccgggacaccggcacctacttc
caccccaccggcaagcgctccgcggaccggctgctgtggcttcagcacgcgtccactcca
cagggcgcgctcaccctcgacgacggggccgtgcgcgcggtcgtcgagcggcgcaagtcg
ctgctgcccgcgggcatcgccgcggtcgagggcgagttcaccgcgggggaccccgtcgag
ttgcgcgacagtgaggggcgcgcggtggcgcgggggctcgtgagcttcgacgccaaggag
atcccgcagctgctcggccgctcgacgcgggaactggcgcgcgagctcggtcccgcgtac
gaacgagaggtcgtacacagggacgatctcgtcctgctgcaaccgtga

DBGET integrated database retrieval system