KEGG   Streptomyces avermitilis: SAVERM_5628Help
Entry
SAVERM_5628       CDS       T00126                                 

Gene name
recO
Definition
(GenBank) putative DNA recombination and repair protein
  KO
K03584  DNA repair protein RecO (recombination protein O)
Organism
sma  Streptomyces avermitilis
Pathway
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SAVERM_5628 (recO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_5628 (recO)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     SAVERM_5628 (recO)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SAVERM_5628 (recO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecO_C RecO_N RecO_N_2 ArfGap
Motif
Other DBs
NCBI-ProteinID: BAC73340
NITE: SAV5628
UniProt: Q82BS6
Position
6805871..6806626
Genome map
AA seq 251 aa AA seqDB search
MGLMSLFRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHV
DVQFFSRGSELIGRGLPLCTQSETIAPYGGAIVTDYARYTAGTAMLETAERFTDHEGEPA
VQQYLLLVGGLRTLARGEHEPHLVLDAFLLRSLAVNGYAPSFSNCAKCGMPGPNRFFSVA
AGGSVCVDCRVPGSVVPSAQALVLLGALLTGDWETADACEPRYVREGSGLVSAYLHWHLE
RGLRSLRYVEK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcatgagtctgttccgcgacgacggcatcgtgctgcgcacccagaagctgggt
gaggcggaccggatcatcaccttgctcacgcgtggtcacggacgcgtacgcgccgtggcg
cgcggtgtgcggcggaccaagtcgaagttcggggcgcggctggagccgttctcccacgtg
gacgtgcagttcttctcgcgcgggagcgagctgatcgggcgcggcctgcccctgtgcaca
cagagcgagaccatcgctccgtacggtggcgccatcgtgacggactacgcgcggtacacc
gccgggacggccatgctcgagaccgccgagcggttcaccgatcacgagggggagcccgcc
gtgcagcagtatctgctgctggtcggcgggctgcgcacgctcgcccggggggaacacgaa
ccccacctcgtgctcgacgccttcctgctgcgctccctcgccgtgaacgggtacgcgccc
agcttcagcaactgcgcgaagtgcggaatgccggggccgaaccggttcttctcggtggcc
gcgggcggctccgtctgcgtcgactgccgggtgcccggcagcgtcgtaccctcggcgcag
gcgctggtgctgctcggcgcgctgctgacgggagactgggagaccgcggacgcctgtgag
ccgcggtacgtccgggagggcagcggcctggtgtcggcctatctgcactggcacctggag
cgcggcctgcgctccctgcgttacgtcgagaagtag

DBGET integrated database retrieval system