KEGG   Streptomyces avermitilis: SAVERM_5629Help
Entry
SAVERM_5629       CDS       T00126                                 

Gene name
uppS2
Definition
(GenBank) putative undecaprenyl diphosphate synthase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
sma  Streptomyces avermitilis
Pathway
sma00550  Peptidoglycan biosynthesis
sma00900  Terpenoid backbone biosynthesis
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAVERM_5629 (uppS2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAVERM_5629 (uppS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sma01006]
    SAVERM_5629 (uppS2)
Enzymes [BR:sma01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     SAVERM_5629 (uppS2)
Prenyltransferases [BR:sma01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SAVERM_5629 (uppS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-ProteinID: BAC73341
NITE: SAV5629
UniProt: Q82BS5
Position
6806695..6807552
Genome map
AA seq 285 aa AA seqDB search
MVVRGILGRQRREYRAPEPHPSGARAPKLPGELIPNHVACVMDGNGRWAKERGLPRTEGH
KVGEGVVMDVLKGCIELGVKNLSLYAFSTENWKRSPEEVRFLMNFNRDVIRRRRDEMDAL
GIRIRWVGRMPKLWKSVVQELQIAQEQTKDNDAMTLYFCVNYGGRAELADAAKAMAEDVA
AGRLDPAKVSEKTIQKYLYYPDMPDVDLFLRPSGEQRTSNYLLWQSSYAEMVFQDVLWPD
FDRRDLWRACVEYASRDRRFGGAVPNEQLLEMERDMKGSEGVQDA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtacgcgggatcctgggacgccagcgccgcgagtacagggcgccggagccgcac
ccgtccggtgcccgcgcgcccaaactccccggcgagctgatcccgaaccatgtcgcgtgt
gtcatggacgggaacggccggtgggccaaggagcgcgggctgccgcgcaccgaggggcac
aaggtcggcgagggcgtcgtcatggacgtcctcaagggctgtatcgagctgggcgtgaag
aacctgtccctgtacgccttctcgacggagaactggaagcggtcgcccgaggaggtccgc
ttcctgatgaacttcaaccgggacgtcatccggcgccggcgggacgagatggacgcgctc
gggatccggatccgctgggtaggccgcatgccgaagctctggaagtccgtcgtccaggaa
cttcagatcgcccaggagcagaccaaggacaacgacgccatgacgctgtacttctgcgtc
aactacggcggccgtgcggagctcgccgacgcggcgaaggcgatggccgaggatgtcgcg
gccggccgtctcgaccccgccaaggtcagcgagaagaccatccagaagtacctgtactac
ccggacatgccggacgtcgacctcttcctgcgccccagcggcgagcagcgcacctcgaac
tacctgctctggcagtcgagttacgcggagatggtcttccaggacgtgctgtggcccgac
ttcgaccggcgtgacctgtggcgcgcctgcgtcgagtacgcctcccgtgaccgccgcttc
ggcggcgccgttccgaacgagcagctgctcgagatggagcgggacatgaaggggagcgaa
ggcgtccaggacgcctga

DBGET integrated database retrieval system