KEGG   Streptomyces avermitilis: SAVERM_5654
Entry
SAVERM_5654       CDS       T00126                                 

Gene name
ppdK
Definition
(GenBank) putative pyruvate phosphate dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_5654 (ppdK)
   00620 Pyruvate metabolism
    SAVERM_5654 (ppdK)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.1  pyruvate, phosphate dikinase
     SAVERM_5654 (ppdK)
SSDB
Motif
Pfam: PEP-utilizers_C PPDK_N PEP-utilizers Dabb PYC_OADA
Other DBs
NCBI-ProteinID: BAC73366
NITE: SAV5654
UniProt: Q82BQ0
Position
6837828..6840578
AA seq 916 aa
MSENKDPQVADVAESGVAGVKFVYDFTEGNKDLKDLLGGKGANLAEMTNLGLPVPPGFTI
TTEACKTYLDSGEEPAALRDEVSAHLDALEAKMGKKLGQADDPLLVSVRSGAKFSMPGMM
DTVLNIGLSDKSVQGLAKQAGDDRFAWDSYRRLIQMFGKTVLGVDGELFEDALEAAKAAK
KVTIDTDLEAADLKRLVTKFKKIVKTEAGRDFPQDAREQMDLAIHAVFDSWNTDRAKLYR
RQERIPHDLGTAVNVCSMVFGNLGPDSGTGVAFTRDPASGHQGVYGDYLQNAQGEDVVAG
IRNTVPLAELEQIDKKSYDQLMQIMATLENHYKDLCDIEFTIERGQLWMLQTRVGKRTAG
AAFRIATQLVDQGLIDEAEALQRVNGAQLAQLMFPRFDDQAKVEQIGRGIAASPGAAVGK
AVFDSYTAIKWSRSGEKVILIRRETNPDDLDGMIAAEGILTSRGGKTSHAAVVARGMGKT
CVCGAEELEVDTKRRRMTAPGGVVVEEGDVVSIDGSSGKVYLGEVPVVPSPVVEYFEGRM
HAGADDADELVAAVHRIMAFADRKRRLRVRANADNAEDALRARRFGAQGIGLCRTEHMFL
GDRRELVERLILADTDAEREESLKELLPLQKKDFIELFEAMDGLPVTVRLLDPPLHEFLP
DITELSVRVALAESRKDSNENDLRLLQAVHRLHEQNPMLGLRGVRLGLVIPGLFTMQVRA
IAEAAAERKAAKGDPRAEIMIPLVGTVQELEIVRDEADQVIAEVQAATGTELKLAIGTMI
ELPRAALTAGQIAEAAEFFSFGTNDLTQTVWGFSRDDVEASFFTAYLEKGIFGVSPFETI
DKDGVGKLVRDAAVAGRATRPDLKLGVCGEHGGDPESVHFFHEVGLDYVSCSPFRIPVAR
LEAGRAASQSAGSDHR
NT seq 2751 nt   +upstreamnt  +downstreamnt
gtgtcggaaaacaaagatccccaggtagctgacgtagccgagagcggcgtcgcgggcgtg
aagttcgtttatgacttcaccgagggcaacaaggacctcaaggacctcctcggcggcaag
ggtgcgaacctcgccgagatgaccaacctgggccttcccgtccctccgggcttcacgatc
accactgaggcgtgcaagacctacctcgacagtggcgaggagccggcggcactgcgtgac
gaggtgagtgcgcacctcgacgccctcgaggcgaagatgggcaagaagctcggccaggcc
gacgacccgctcctggtgtccgtccgttccggtgcgaagttctccatgccgggcatgatg
gacacggtcctgaacatcggcctctccgacaagtcggtgcagggcctggccaagcaggcc
ggcgacgaccgcttcgcgtgggactcgtaccgccgcctcatccagatgttcggcaagacg
gtcctcggcgtcgacggcgaactcttcgaggacgcgctggaggcggcgaaggcggccaag
aaggtcacgatcgacacggacctcgaggcggccgacctcaagaggctcgtcaccaagttc
aagaagatcgtcaagaccgaggcgggccgggacttcccgcaggacgcgcgcgagcagatg
gacctcgccatccacgcggtcttcgactcctggaacaccgaccgcgccaagctctaccgc
cgtcaggagcgcatcccgcacgacctcggcacggcggtcaacgtctgttcgatggtcttc
ggcaacctgggccccgactcgggcacgggtgtggccttcacccgggaccccgcctccggc
caccagggcgtctacggcgactacctccagaacgcccagggcgaggacgtggtcgcgggc
atccgcaacacggtcccgctcgccgagctggagcagatcgacaagaagtcgtacgaccag
ctgatgcagatcatggcgaccttggagaaccactacaaggacctctgcgacatcgagttc
accatcgagcgcggccagctgtggatgctccagacccgcgtcggcaagcgcacggcgggc
gcggccttccggatcgcgacgcagctggtggaccagggcctgatcgacgaggcggaggcg
ctccagcgggtcaacggcgcccagctcgcgcagctgatgttcccgcgcttcgacgaccag
gcgaaggtcgagcagatcggccggggcatcgcggcgtcgccgggcgccgcggtcggcaag
gcggtcttcgactcgtacacggcgatcaagtggtcgcgttcgggcgagaaggtcatcctg
atccgccgggagacgaacccggacgacctggacggcatgatcgcggcggagggcatcctg
acctcgcgcggcggcaagacgtcgcacgcggccgtcgtggcccggggcatgggcaagacc
tgtgtgtgcggtgcggaggagctcgaggtcgacacgaagcggcgccggatgacggctccc
ggcggtgtcgtggtcgaggagggcgacgtcgtctccatcgacggttcgagcggcaaggtg
tacctgggtgaggtgccggtcgtgccctcccccgtggtggagtacttcgagggccggatg
cacgcgggtgccgacgacgccgacgagctggtggcggcggtgcaccggatcatggcgttc
gcggaccgcaagcgccggctgcgggtgcgggcgaacgcggacaacgcggaggacgcgctg
cgggcgcgccgcttcggggcgcagggcatcggcctgtgccgcacggagcacatgttcctg
ggcgaccgccgggagctggtcgagcgcctgatcctcgccgacacggacgcggagcgcgag
gagtccctcaaggaactgctcccgctccagaagaaggacttcatcgagctgttcgaggcg
atggacggcctgccggtgacggtccggctcctggacccgccgctgcacgagttcctgccg
gacatcacggagctgtcggtccgtgtcgcgctcgccgagtcccgcaaggactccaacgag
aacgacctgcgcctgctccaggcggtgcaccggctgcacgagcagaacccgatgctgggc
ctgcgcggtgtccgtctcggcctggtcatccccggcctgttcaccatgcaggtgcgggcg
atcgcggaggcggcggcggagcggaaggccgcgaagggcgacccgcgggccgagatcatg
atcccgctggtgggcacggtccaggagctggagatcgtgcgcgacgaggcggaccaggtc
atcgcggaggtgcaggcggcgacgggtacggagctgaagctggccatcggcacgatgatc
gagctgccgcgcgccgcgctcacggccggtcagatcgccgaggcggccgagttcttctcc
ttcggcacgaacgacctgacgcagacggtgtggggcttcagccgggacgacgtggaggcc
tccttcttcaccgcgtacctggagaagggcatcttcggtgtctccccgttcgagacgatc
gacaaggacggcgtgggcaagctggtccgcgacgcggcggtcgcgggccgggcgacgcgg
cccgacctgaagctgggcgtgtgcggcgagcacggcggcgacccggagtcggtccacttc
ttccacgaggtcggcctcgactacgtgtcctgctcgccgttccggattccggtggcccgc
ctggaggcggggcgcgcggcctcgcagtcggcgggaagcgaccaccggtaa

DBGET integrated database retrieval system