KEGG   Streptomyces avermitilis: SAVERM_5676Help
Entry
SAVERM_5676       CDS       T00126                                 

Gene name
dnaG
Definition
(GenBank) putative DNA primase
  KO
K02316  DNA primase [EC:2.7.7.101]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_5676 (dnaG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_5676 (dnaG)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.101  DNA primase DnaG
     SAVERM_5676 (dnaG)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SAVERM_5676 (dnaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_N zf-CHC2 Toprim_4 DnaG_DnaB_bind DnaB_bind Toprim_2 Toprim Toprim_3
Motif
Other DBs
NCBI-ProteinID: BAC73388
NITE: SAV5676
UniProt: Q82BM8
Position
6864460..6866358
Genome map
AA seq 632 aa AA seqDB search
MAGRINDEDVKAVRDAVPIDAVVSEYLQLRNAGGGNLKGLCPFHDEKSPSFQVSPSKGLF
HCFGCQEGGDTITFVMKVDHLTFSEVVERLAAQAGITLRYEEGGYNPSHQRGERIRLVEA
HKIAAQFYIEQLDTGSEADTGRKFLAERGFDQAAAAHFGVGYSPQGWDHLTRYLRGKGFT
DKELLLSGLSQEGRRGPIDRFRGRLMWPIRDIGGDVVGFGARKLYESDNGPKYLNTPDTA
IYRKSQVLYGIDLAKKDIAKVSRAVVVEGYTDVMACHLAGVTTAIATCGTAFGTDHIKIL
RRLLMDNGSARVIFTFDGDAAGQKAALRAFEDDQKFAAETYIAIAPDGMDPCELRLAKGD
EAVADLVEPRTPLFEFALRQIVARYDLETPAGRAAALDESAPIVARIKNSGAQHEVAVQL
AGMLGILDTQFVVKRVSQLARWARDRGGKGPAPAQQRPQQSYAAVQVPSGPALHLRNPVY
ATERELLKLALQRPELVSPAFDAYGIDEFTAPQYAAVREAIIEAGGAEYGVQDPQEYLVR
VREVAPDDTVRAMVTELAVEAIMRRTVDEAYAGDQLVTVRRRAVERRVREVQGSLARLSA
GGDPAQLAAVQNELWVLQQYDQALRERGAQAL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggacggatcaacgacgaggacgtgaaggcggttcgggacgcggtcccgatcgac
gccgtcgtctccgagtacctccagctgcggaacgcgggcggcggcaacctgaagggcctg
tgcccgttccacgacgagaagtcaccgtccttccaggtcagcccgagcaagggactcttc
cactgcttcggctgccaggagggcggcgacaccatcacgttcgtgatgaaggtcgaccac
ctcaccttctcggaggtggtcgagcgcctcgccgcccaggccggcatcaccctgcgctac
gaggagggcggatacaacccctcccaccagcgcggcgagcgcatccgcctggtcgaggcc
cacaagatcgccgcccagttctacatcgagcagctcgacaccggctccgaggccgacacg
ggccgcaagttcctcgccgagcgcggcttcgaccaggccgccgccgcacacttcggcgtc
ggctacagcccccagggctgggaccacctcacccgctatctccgcggcaagggcttcacc
gacaaggagctgctcctctccggcctctcccaggaaggccgccgcggccccatcgaccgc
ttccgcggccggctgatgtggccgatccgcgacatcggcggcgacgtggtcggcttcggc
gcgagaaagctgtacgagtccgacaacggacccaagtacctcaacacccccgacaccgcg
atctaccggaagtcccaggtcctctacggcatcgacctcgccaagaaggacatcgccaag
gtcagccgggcggtcgtggtcgagggctacacggacgtcatggcctgccacctggccggc
gtcaccaccgcgatcgccacctgcggcacggccttcggcaccgaccacatcaagatcctc
cgccggctgctgatggacaacggcagcgcacgcgtgatcttcaccttcgacggcgacgcg
gcgggccagaaggccgccctgcgcgccttcgaggacgaccagaagttcgccgccgagacc
tacatcgccatcgcacccgacggcatggacccctgcgagctgcgcctcgcgaagggcgac
gaggcggtcgccgacctggtcgaaccccgtacgccgctcttcgagttcgcgctgcgccag
atcgtcgcgcgctacgacctggagaccccggcgggccgcgccgccgcactggacgagtcg
gcgccgatcgtggcccgcatcaagaacagcggcgcccagcacgaggtcgccgtccagctc
gcgggcatgctcggcatcctcgacacccagttcgtggtcaagcgggtcagccagctggcg
cgttgggcgcgcgaccggggcggcaagggccccgcccccgcccagcagcgcccccagcag
tcgtacgcggccgtccaggtcccctcgggccccgccctgcacctccgcaaccccgtctac
gccaccgagcgcgagctgctcaaactcgccctccagcgcccggagctggtctccccggcc
ttcgacgcgtacgggatcgacgagttcaccgccccgcagtacgcggccgtacgggaggcg
atcatcgaggcgggcggcgcggagtacggcgtccaggacccgcaggagtacctggtccgc
gtccgtgaggtcgcgccggacgacacggtgcgcgccatggtcacggagctggccgtcgag
gcgatcatgcgccggacggtcgacgaggcgtacgcgggcgaccagctggtcaccgtgcgc
cgccgcgcggtggagcggcgcgtgcgcgaggtccagggcagcctggcccgcctgagcgcg
ggcggcgaccccgcccagctggccgccgtgcagaacgagttgtgggtgctccagcagtac
gaccaggcgctgcgcgagcgaggcgcccaggcgctctga

DBGET integrated database retrieval system