KEGG   Streptomyces avermitilis: SAVERM_5954
Entry
SAVERM_5954       CDS       T00126                                 

Gene name
glnA1
Definition
(GenBank) putative glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00250  Alanine, aspartate and glutamate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00910  Nitrogen metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01230  Biosynthesis of amino acids
sma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_5954 (glnA1)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SAVERM_5954 (glnA1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_5954 (glnA1)
   00220 Arginine biosynthesis
    SAVERM_5954 (glnA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAVERM_5954 (glnA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_5954 (glnA1)
Enzymes [BR:sma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     SAVERM_5954 (glnA1)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_5954 (glnA1)
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N Gln-synt_N_2
Other DBs
NCBI-ProteinID: BAC73666
NITE: SAV5954
UniProt: Q82AV1
Position
7168307..7169668
AA seq 453 aa
MDKQQEFVLRTLEERDIRFVRLWFTDVLGFLKSVAVAPAELEQAFDEGIGFDGSAIEGFA
RVYESDMIAKPDPSTFQVLPWRAEAPGTARMFCDILMPDGSPSFADPRYVLKRALAKTSD
LGFTFYTHPEIEFFLLKDKPLDGSRPTPADNSGYFDHTPQNVGMDFRRQAITMLESMGIS
VEFSHHEGAPGQQEIDLRYADALSTADNIMTFRLVMKQVALEQGVQATFMPKPFSEYPGS
GMHTHLSLFEGDRNAFYESGSEYQLSKVGRSFIAGLLKHAAEISAVTNQWVNSYKRIWGG
SERTAGAGGEAPSYICWGHNNRSALVRVPMYKPGKTGSARVEVRSLDSGANPYLAYALLL
AAGLKGIEEGYELPPGADDDVWALSDAERRAMGIEPLPQNLGEALALMQRSELAAETLGE
HVFDFFLRNKKQEWEEYRSEVTAFELRKNLPVL
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggacaagcagcaggagttcgtgctccggacactggaggagcgcgacatccggttcgta
cgtctgtggttcacggacgtactcggcttcctcaagtcggtggccgtcgccccggccgag
ctggaacaggccttcgacgagggcatcggcttcgacggctcggccatcgagggcttcgcc
cgtgtatacgagtccgacatgatcgccaagccggacccgtcgacgttccaggtcctgccg
tggcgcgccgaggcccccggcacggcccgcatgttctgcgacatcctcatgccggacggc
tccccgtccttcgcggacccgcgctacgtcctcaagcgcgccctcgccaagacctccgac
ctgggcttcaccttctacacccacccggagatcgagttcttcctgctgaaggacaagccg
ctggacggctcgcgcccgaccccggccgacaactccggctacttcgaccacaccccgcag
aacgtcggcatggacttccgccgccaggcgatcaccatgctggagtcgatgggcatctcg
gtcgagttctcccaccacgagggcgcgcccggccagcaggagatcgacctgcgctacgcc
gacgccctctcgacggcggacaacatcatgacgttccgcctggtcatgaagcaggtggcg
ctggagcagggcgtgcaggcgaccttcatgccgaagccgttctcggagtacccgggcagc
ggcatgcacacccacctctcgctcttcgagggcgaccgcaacgcgttctacgagtccggc
tcggagtaccagctctccaaggtcggccgctccttcatcgccggcctgctgaagcacgcg
gcggagatctcggccgtcaccaaccagtgggtcaactcctacaagcgcatctggggcggc
tcggagcgcacggcaggcgccggcggcgaggctccgtcgtacatctgctggggccacaac
aaccgctccgcactggtccgcgtcccgatgtacaagcccggcaagaccggctcggcccgc
gtcgaggtccgctccctcgactcgggcgcgaacccgtacctggcgtacgcgctgctcctc
gcggcgggcctcaagggcatcgaggagggctacgagctcccgccgggcgccgacgacgac
gtgtgggccctctcggacgcggagcgccgcgcgatgggcatcgagcccctgccgcagaac
ctcggcgaggcgctggcactcatgcagcgcagcgagctggccgccgagaccctgggcgag
cacgtcttcgacttcttcctgcgcaacaagaagcaggagtgggaggagtaccgctccgag
gtgacggccttcgagctgcggaagaacctgccggtgctgtag

KEGG   Streptomyces avermitilis: SAVERM_5997
Entry
SAVERM_5997       CDS       T00126                                 

Gene name
glnA2
Definition
(GenBank) putative glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00250  Alanine, aspartate and glutamate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00910  Nitrogen metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01230  Biosynthesis of amino acids
sma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_5997 (glnA2)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SAVERM_5997 (glnA2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_5997 (glnA2)
   00220 Arginine biosynthesis
    SAVERM_5997 (glnA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAVERM_5997 (glnA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_5997 (glnA2)
Enzymes [BR:sma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     SAVERM_5997 (glnA2)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_5997 (glnA2)
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N
Other DBs
NCBI-ProteinID: BAC73709
NITE: SAV5997
UniProt: Q82AQ9
Position
complement(7223809..7224837)
AA seq 342 aa
MTFKAEYIWIDGTEPTAKLRSKTKILADDAKGAELPIWGFDGSSTNQAEGHASDRVLKPV
ATYPDPIRGGDDVLVMCEVLNIDMTPHESNTRATLAEVEEKFGAQEPIFGIEQEYTFFKG
SRPLGFPEGGFPAAQGGYYCGVGSDEIFGRDVVEAHLENCLKAGLGISGINAEVMPGQWE
FQVGPLAPLEVSDQLWVARWLLYRTAEDFGVSATLDPKPVKGDWNGAGAHTNFSTKAMRE
GYDAIITACESLGEGSKPLDHVKNYGAGIDDRLTGLHETAPWNEYSYGVSNRGASVRIPW
QVEKDGKGYIEDRRPNANVDPYVVTRLLVDTCCSALEKAGQV
NT seq 1029 nt   +upstreamnt  +downstreamnt
gtgaccttcaaggctgagtacatctggatcgacggcaccgagccgacggccaagctccgt
tcgaagacgaagatcctggcggacgatgccaagggtgccgagctgccgatctggggcttc
gacgggtcctccacgaaccaggccgaggggcacgcctccgaccgcgtactcaagccggtc
gccacctacccggacccgatccgcggcggcgacgacgtcctcgtcatgtgcgaggtcctg
aacatcgacatgacgccgcacgagtccaacacgcgtgccacgctggccgaggtcgaggag
aagttcggcgcccaggagccgatcttcggcatcgagcaggagtacaccttcttcaagggc
tcgcgcccgctgggcttccccgagggcggcttcccggccgcgcagggcggctactactgc
ggtgtcggctcggacgagatcttcggccgtgacgtcgtcgaggcgcacctggagaactgc
ctcaaggcgggtctgggcatctccggcatcaacgccgaggtcatgcccggccagtgggag
ttccaggtcggcccgctggcgccgctcgaggtctccgaccagctgtgggtggcccgctgg
ctgctctaccgcaccgccgaggacttcggcgtctccgcgacgctggacccgaagccggtg
aagggcgactggaacggcgcgggcgcgcacaccaacttctccacgaaggcgatgcgcgag
ggctacgacgcgatcatcaccgcgtgcgagtcgctgggcgagggctccaagccgctcgac
cacgtcaagaactacggcgcgggcatcgacgaccgcctgacgggcctgcacgagaccgcc
ccgtggaacgagtactcgtacggcgtctcgaaccgtggcgcctcggtccgtatcccgtgg
caggtcgagaaggacggcaagggctacatcgaggaccgccgtccgaacgccaacgtcgac
ccgtacgtcgtgacgcgtctgctcgtcgacacctgctgctccgccctggagaaggccggc
caggtctga

KEGG   Streptomyces avermitilis: SAVERM_6005
Entry
SAVERM_6005       CDS       T00126                                 

Gene name
glnA3
Definition
(GenBank) putative glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00250  Alanine, aspartate and glutamate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00910  Nitrogen metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01230  Biosynthesis of amino acids
sma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_6005 (glnA3)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SAVERM_6005 (glnA3)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_6005 (glnA3)
   00220 Arginine biosynthesis
    SAVERM_6005 (glnA3)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAVERM_6005 (glnA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_6005 (glnA3)
Enzymes [BR:sma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     SAVERM_6005 (glnA3)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_6005 (glnA3)
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N
Other DBs
NCBI-ProteinID: BAC73717
NITE: SAV6005
UniProt: Q82AQ1
Position
complement(7231951..7233360)
AA seq 469 aa
MFQNADEAKKYIADEDVKFVDVRFCDLPGVMQHFTIPAEAFDPAEELAFDGSSIRGFQAI
HESDMALRADLSTARVDPFRRDKTVNINFFIHDPITGEQYSRDPRNVAKKAEAYLASTGI
ADTAYFGPEAEFYVFDSVRFKTAENESFYHIDSEAGAWNTGAIEDNRGYKVRYKGGYFPT
PPVDHFADLRAEISLELANSGLQVERQHHEVGTAGQAEINYKFNTLLAAADDLQLFKYIV
KNVAWRNGKTATFMPKPIFGDNGSGMHVHQSLWANGDPLFYDEAGYAGLSDTARYYIGGI
LKHAPSLLAFTNPTVNSYHRLVPGFEAPVNMVYSQRNRSAAMRIPITGSNPKAKRVEFRA
PDSSGNPYLAFSALLLAGLDGIKNKVEPAEPIDKDLYELAPEEHASVAQVPTSLPAVLSA
LEADHEYLLQGNVFTPDLIETWIDYKRTNEIAPLQLRPHPHEFELYFDV
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgttccagaacgccgacgaggccaagaagtacatcgcggacgaggacgtcaagttcgtc
gacgtccggttctgcgacctgccgggcgtgatgcagcacttcacgattccggcggaggcc
ttcgacccggccgaggagctggccttcgacggctcctcgatccgcggcttccaggccatc
cacgagtccgacatggcgctccgcgccgacctgtccaccgcgcgcgtcgaccccttccgc
cgcgacaagacggtcaacatcaacttcttcatccacgacccgatcacgggcgagcagtac
tcccgtgacccgcgcaacgtggcgaagaaggccgaggcctacctcgcgtcgaccggcatc
gccgacaccgcgtacttcggccccgaggccgagttctacgtcttcgacagcgtgcgcttc
aagaccgcggagaacgagtccttctaccacatcgactccgaggccggcgcctggaacacc
ggtgcgatcgaggacaaccgcggctacaaggtccgctacaagggcggttacttcccgacc
ccgccggtcgaccacttcgccgacctgcgtgccgagatctccctggagctggccaactcc
ggcctccaggtcgagcgccagcaccacgaggtgggcaccgccggccaggccgagatcaac
tacaagttcaacacgctgctcgccgcggccgacgacctccagctcttcaagtacatcgtg
aagaacgtcgcctggcgcaacggcaagaccgcgaccttcatgccgaagccgatcttcggt
gacaacggctcgggcatgcacgtccaccagtcgctgtgggccaatggcgacccgctgttc
tacgacgaggccggttacgcgggcctctcggacaccgcccgctactacatcggcggcatc
ctcaagcacgccccgtcgctgctggccttcaccaacccgacggtgaactcgtaccaccgt
ctggtcccgggcttcgaggccccggtcaacatggtctactcgcagcgcaaccgctcggcc
gcgatgcgtatcccgatcaccggctcgaacccgaaggccaagcgcgtcgagttccgcgcc
ccggactcctccggcaacccgtacctcgccttctcggcgctgctgctcgcgggcctcgac
ggcatcaagaacaaggtcgagccggccgagccgatcgacaaggacctctacgagctggcc
cccgaggagcacgcgagcgtcgcgcaggtcccgacctcgctcccggccgtgctcagcgcc
ctcgaggccgaccacgagtacctgctccagggcaacgtcttcacgcccgacctgatcgag
acgtggatcgactacaagcgcacgaacgagatcgccccgctccagctgcgcccgcacccg
cacgagttcgagctctacttcgacgtctaa

KEGG   Streptomyces avermitilis: SAVERM_6725
Entry
SAVERM_6725       CDS       T00126                                 

Gene name
glnA4
Definition
(GenBank) putative glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00250  Alanine, aspartate and glutamate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00910  Nitrogen metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01230  Biosynthesis of amino acids
sma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_6725 (glnA4)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SAVERM_6725 (glnA4)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_6725 (glnA4)
   00220 Arginine biosynthesis
    SAVERM_6725 (glnA4)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAVERM_6725 (glnA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_6725 (glnA4)
Enzymes [BR:sma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     SAVERM_6725 (glnA4)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_6725 (glnA4)
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N_2 Gln-synt_N
Other DBs
NCBI-ProteinID: BAC74436
NITE: SAV6725
UniProt: Q828E4
Position
8041036..8042400
AA seq 454 aa
MADRTPPLGVEELHALVAGGEIDTVVLAFPDMQGRLQGKRFAARFFLDEVLEHGTEGCNY
LLAVDTDMNTVDGYDMSSWDRGYGDFAMHPDLSTLRQVPWNAGTALLIADLAWNDGSPVV
AAPRQILRRQLDRLAALGYTAQVGTELEFIVFKDTYEQAWDAGYKGLTPANQYNIDYSVL
GTGRIEPLLRRIRNEMQAAGLTVESAKGECNPGQHEIVFRYDEALVTCDQHAVYKTGAKE
IAAQEGVSITFMAKYNEREGNSCHIHLSLADADGTNAMAGDGPGGMSDVMRHFLAGQLAA
LRDFSLLYAPNINSYKRFQPGSFAPTAVAWGYDNRTCALRVVGHGRSMRFENRLPGGDVN
PHLAVAGLVAAGLYGIEHKLELPEACAGNAYAAEYEHVPTTLREAAELWENSPIAKAAFG
DDVVAHYRNMARVELKAFDAAVTDWELRRSFERL
NT seq 1365 nt   +upstreamnt  +downstreamnt
gtggcagaccgcacaccaccgctcggtgtcgaggagctgcacgccctcgtcgcgggcggc
gagatcgacactgtcgtcctcgcgttccccgatatgcaagggcgcctccagggcaagcgg
ttcgccgcgcgcttcttcctcgacgaggtgctggagcacggcacggagggatgcaactac
ctgctcgccgtcgacaccgacatgaacaccgtcgacggctatgacatgtcctcctgggac
cgcgggtacggcgacttcgccatgcatcccgacctgagcacgctgcgccaggtgccgtgg
aacgcgggcacggcgctgctgatcgccgacctcgcctggaacgacggatcgccggtggtc
gccgccccccgccagatcctgcgtcgccagctcgaccggctcgccgccctcggctacacc
gcccaggtcggcaccgagctggagttcatcgtcttcaaggacacctacgagcaggcctgg
gacgccggatacaaggggctcacaccggccaaccagtacaacatcgactactcggtgctc
gggacgggacggatcgaacccctgctgcgccgcatccgcaacgagatgcaggccgcgggc
ctcaccgtcgagtcggccaagggcgagtgcaaccccggccagcacgagatcgtgttccgg
tacgacgaggccctggtcacctgcgaccagcacgccgtctacaagaccggcgccaaggag
atcgccgcccaggagggcgtgtcgatcaccttcatggccaagtacaacgagcgcgagggc
aactcctgccacatccacctgtcgctggcggacgcggacggcaccaacgccatggccggc
gacggacccggcggcatgtcggacgtcatgcgccacttcctcgccgggcagctcgccgcg
ctgcgcgacttctcacttctgtacgcgcccaacatcaactcgtacaagcggttccagccg
ggctccttcgcgccgaccgccgtggcctggggctacgacaaccgcacctgcgcgctgcgg
gtggtcggccacggccgctcgatgcgcttcgagaaccggctccccggcggtgacgtcaac
ccgcacctcgccgtcgccggactcgtcgcggccggcctgtacggcatcgagcacaagctg
gagctgcccgaggcctgcgcgggcaacgcctacgccgccgagtacgagcacgtccccacc
accctgcgcgaggcggccgaactctgggagaacagccccatcgccaaggccgccttcggc
gacgacgtggtcgcccactaccgcaacatggcgcgcgtcgaactgaaggccttcgacgcc
gcggtgaccgactgggagctgcgccgctccttcgaacgcctgtga

DBGET integrated database retrieval system