KEGG   Streptomyces avermitilis: SAVERM_6080
Entry
SAVERM_6080       CDS       T00126                                 

Gene name
plsC3
Definition
(GenBank) putative 1-acylglycerol-3-phosphate O-acyltransferase
  KO
K00655  1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
sma  Streptomyces avermitilis
Pathway
sma00561  Glycerolipid metabolism
sma00564  Glycerophospholipid metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_6080 (plsC3)
   00564 Glycerophospholipid metabolism
    SAVERM_6080 (plsC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sma01004]
    SAVERM_6080 (plsC3)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     SAVERM_6080 (plsC3)
Lipid biosynthesis proteins [BR:sma01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   SAVERM_6080 (plsC3)
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-ProteinID: BAC73791
NITE: SAV6080
UniProt: Q82AH7
Position
7316297..7317079
AA seq 260 aa
MIYGAMKFSIGGPLKLAFRPWVEGLENIPAEGPAILASNHLSFSDSFFLPAVLDRKVTFI
AKAEYFTTPGIKGRMTAAFFKGVGQLPVDRSGARGAGEAAIKSGIEVIERGELFGIYPEG
TRSPDGRLYRGKPGGLARVALATGAPVIPVAMIDTEKIQPPGKVMPKLMRPGIRIGKPLD
FGRYSGMEHDRFVLRAVTDEVIYEIMKLSGQEYVDMYATAAKRQIADAAKAEKQAQKDAE
KQAQKELEARQALEKERSGS
NT seq 783 nt   +upstreamnt  +downstreamnt
ttgatctacggcgccatgaagttttccatcggggggccactgaagcttgccttcaggccc
tgggtggaaggcctcgagaacattcccgccgagggacccgccatcctggcgagcaatcac
ctgtcgttctcggactcgttcttcctgcccgcggtcctcgaccgcaaggtgaccttcatc
gcgaaggccgagtacttcacgactcccggcatcaaggggcgtatgacggccgccttcttc
aagggcgtcggtcagctgccggtggaccgctccggcgcgcgcggcgcgggcgaggcggcc
atcaagagcggcatcgaagtcatcgagcggggtgagctgttcggtatctacccggagggc
acgcgctcgcccgacggccggctgtaccgcggcaagcccggcggtctcgcgcgcgtggca
ctcgccaccggcgcgcccgtcatcccggtcgccatgatcgacaccgagaagatccagccg
cccgggaaggtgatgcccaagctgatgcgcccgggcatccgcatcggcaagccgctggac
ttcggccgctacagcggcatggagcacgaccgcttcgtgctgcgcgcggtgaccgacgag
gtcatctacgagatcatgaagctctccggccaggagtacgtcgacatgtacgccacggcc
gcgaagcggcagatcgcggacgcggcgaaggccgagaagcaggcccagaaggacgccgaa
aagcaggcgcagaaggaactcgaggcccggcaggccctggagaaggaacggtccggctcc
tag

KEGG   Streptomyces avermitilis: SAVERM_6523
Entry
SAVERM_6523       CDS       T00126                                 

Gene name
plsC7
Definition
(GenBank) putative 1-acylglycerol-3-phosphate O-acyltransferase
  KO
K00655  1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
sma  Streptomyces avermitilis
Pathway
sma00561  Glycerolipid metabolism
sma00564  Glycerophospholipid metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_6523 (plsC7)
   00564 Glycerophospholipid metabolism
    SAVERM_6523 (plsC7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sma01004]
    SAVERM_6523 (plsC7)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     SAVERM_6523 (plsC7)
Lipid biosynthesis proteins [BR:sma01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   SAVERM_6523 (plsC7)
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-ProteinID: BAC74234
NITE: SAV6523
UniProt: Q828Y8
Position
7809908..7810624
AA seq 238 aa
MRRHPRRGEAGREVTEAPSVRGAEVGRRIGVGLMYGLFKPRVLGAWKVPATGPVILAVNH
SHNIDGPMVMGVAPRPTHFLIKKEAFVGPLDPFLLGIGQLKVDRETTDRSAVTRAVGVLD
NGGVLGIFPEGTRGEGDFASLRAGLAYFAVRGGAPIVPVAVLGSTERRGRLIKALPPLRS
RVDVVFGDPFEAGDGSGRRTRKALDEATVRIQKQLSAHLENARRLTGRRENAGRPTGH
NT seq 717 nt   +upstreamnt  +downstreamnt
gtgcgtcgtcaccctcgtcgaggagaagcgggccgcgaagtgaccgaggcaccatcggta
cgcggcgccgaggtcgggcggcgcatcggcgtcggcctgatgtacgggctgttcaagccg
cgcgtcctcggggcctggaaggtccccgcgaccggcccggtgatcctcgccgtgaaccac
tcgcacaacatcgacggcccgatggtcatgggcgtggcaccccggccgacccacttcctg
atcaagaaggaagcgttcgtcggcccgctcgaccccttcctgctcggcatcggccagctg
aaggtggaccgcgagaccaccgaccgctcggcggtcacccgcgctgtcggcgtcctcgac
aacggcggcgtcctcggcatcttcccggagggcacccggggcgagggcgacttcgcctcg
ctgcgcgccgggctcgcctacttcgcggtccgtggcggcgccccgatcgtcccggtcgcc
gtcctgggaagcaccgagcggcgcggacggttgatcaaggcgctgcccccgctgcgcagc
cgggtggacgtcgtcttcggcgaccccttcgaggcgggcgacggcagcgggcgacgtacg
cgcaaggcgctcgacgaggcgaccgtgcgcatccagaagcagctgagcgcacacctggaa
aacgccaggcgtctgaccggacgccgggaaaacgccgggcgccccaccgggcactag

KEGG   Streptomyces avermitilis: SAVERM_6783
Entry
SAVERM_6783       CDS       T00126                                 

Gene name
plsC4
Definition
(GenBank) putative 1-acylglycerol-3-phosphate O-acyltransferase
  KO
K00655  1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
sma  Streptomyces avermitilis
Pathway
sma00561  Glycerolipid metabolism
sma00564  Glycerophospholipid metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_6783 (plsC4)
   00564 Glycerophospholipid metabolism
    SAVERM_6783 (plsC4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sma01004]
    SAVERM_6783 (plsC4)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     SAVERM_6783 (plsC4)
Lipid biosynthesis proteins [BR:sma01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   SAVERM_6783 (plsC4)
SSDB
Motif
Pfam: Acyltransferase DUF374
Other DBs
NCBI-ProteinID: BAC74494
NITE: SAV6783
UniProt: Q827Y6
Position
complement(8100895..8101566)
AA seq 223 aa
MSRFVLIKAVLGPIMRLMFRPRVEGAEHIPGEGPVILAGNHLTFIDSMIMPLFCDRQVFF
IGKDEYVTGKGIKGRLMAWFFTGTGMIPVDRDGGRGGVAALMTGRRVLEEGKVFSIYPEG
TRSPDGRLYRGRTGIARLTLMTGAPVVPFAMIGTDKLQPGGAGFPRPGRVTVRFGEAMEF
SRYEGMDRDRYVLRAVTDSVMAEVMRLSGQEYVDMYATKAKAA
NT seq 672 nt   +upstreamnt  +downstreamnt
ttgtcccgcttcgtgctcatcaaggcagtgctcggaccgatcatgcgcctgatgttccgc
ccacgggtggaaggtgcggagcacatcccgggcgaaggtccggtcatcctggccggcaac
cacctcacgttcatcgactcgatgatcatgccgctcttctgcgaccgccaggtcttcttc
atcggcaaggacgagtacgtcaccggcaagggcatcaagggtcggctgatggcctggttc
ttcaccggcaccgggatgatccccgtcgaccgtgacggcggccgcggcggtgtcgcggcg
ctgatgaccggccgccgggtgctggaggagggcaaggtcttcagcatctacccggagggc
acccgctcccccgacggccggctctaccgcggtcgtaccggtatcgcccgcctcaccctg
atgaccggcgccccggtcgtcccgttcgcgatgatcggcaccgacaagctccagccgggc
ggcgccggtttcccgcgccccggccgggtgacggtccgcttcggcgaggcgatggagttc
tcccgctacgagggcatggaccgcgaccgctatgtgctgcgcgccgtgaccgactccgtg
atggccgaggtcatgcgcctttcgggtcaggagtacgtggacatgtacgccaccaaggcg
aaggcggcgtag

KEGG   Streptomyces avermitilis: SAVERM_7111
Entry
SAVERM_7111       CDS       T00126                                 

Gene name
plsC6
Definition
(GenBank) putative 1-acylglycerol-3-phosphate O-acyltransferase
  KO
K00655  1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
sma  Streptomyces avermitilis
Pathway
sma00561  Glycerolipid metabolism
sma00564  Glycerophospholipid metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_7111 (plsC6)
   00564 Glycerophospholipid metabolism
    SAVERM_7111 (plsC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sma01004]
    SAVERM_7111 (plsC6)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     SAVERM_7111 (plsC6)
Lipid biosynthesis proteins [BR:sma01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   SAVERM_7111 (plsC6)
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-ProteinID: BAC74822
NITE: SAV7111
UniProt: Q826R4
Position
complement(8470813..8471538)
AA seq 241 aa
MFYYVLKYVILGPLLKLVFRPRIEGLEHVPSSGPAIVAGNHLSFSDHFLMPAILKRRITF
LAKAEYFTGPGIKGRLTAAFFRSAGQIPVDRSGKDAGQAAIREGLGVLRKDELLGIYPEG
TRSHDGRLYKGKVGVAVMALRAGVPVIPCAMIGTFEAQPPGKVIPNIHPVVIRFGKPLEF
SRYAGMENEKAVLRAITDEIMYAILTLSEQEYVDRYAAVVKAEEAAEKAAKARKFPRIPL
S
NT seq 726 nt   +upstreamnt  +downstreamnt
gtgttttattacgtgctcaaatacgtgattctcggaccgctgttgaagctggtgttccgg
cctcggatcgagggtctcgaacacgtaccgtcgtcgggcccggccatcgtggcgggcaac
catctgtcgttctcggaccacttcctgatgcccgcgatcctcaaacggcgcatcaccttc
ctggcgaaggccgagtacttcacgggccccggcatcaagggccggctcacggccgcgttc
ttccgcagcgccggacagatcccggtggaccgctccggcaaggacgcgggccaggccgcg
atccgcgaaggcctcggcgtgctgcgcaaggacgagctgctcggcatctacccggagggc
acgcgctcgcacgacggccgcctctacaagggcaaggtgggcgtcgcggtgatggccctg
cgggccggggtcccggtgattccctgcgcgatgatcggcaccttcgaggcccagccgccg
ggcaaggtcatcccgaacatccaccccgtcgtgatccgcttcggcaagcccctggagttc
tcccgctacgccggtatggagaacgagaaggcggtcctgcgcgccatcaccgacgagatc
atgtacgccatcctcacgctctccgaacaggagtacgtcgaccggtacgcggcggtcgtc
aaggccgaggaggccgccgagaaggcggcgaaggcccgcaagtttccccggatcccgctg
agttga

DBGET integrated database retrieval system