KEGG   Streptomyces avermitilis: SAVERM_6091Help
Entry
SAVERM_6091       CDS       T00126                                 

Gene name
nfo
Definition
(GenBank) putative endonuclease IV
  KO
K01151  deoxyribonuclease IV [EC:3.1.21.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_6091 (nfo)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6091 (nfo)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.2  deoxyribonuclease IV
     SAVERM_6091 (nfo)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     SAVERM_6091 (nfo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: BAC73802
NITE: SAV6091
UniProt: Q82AG6
Position
complement(7327680..7328612)
Genome map
AA seq 310 aa AA seqDB search
MNNQQSRGALGTSGATPDLPDATPGLSRNPVGGHVPVAGGLHSVGLAYARDLAAEAVQVF
VANPRGWATPAGNPRQDEEFRAACAAESIPAYVHAPYLINFGSHTEATVEKSVESLRHSL
RRGREIGALGVVVHTGSATGGRERSVALAQVREHLLPLLDELTHDDDPYLLLESTAGQGA
SLCSRTWDFGPYFEALDAHPKLGVCLDTCHIFAAGHDLTGPSGMHQTLDLLVDTVGEGRL
KLIHANDSKDVVGAHKDRHENIGSGHIGEDPFRALMTHPATEGVPLIIETPGGKEGHAAD
VEQLKKLRDG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatcagcagtcccgcggcgccctcggcacgtccggcgccacccccgacctgccc
gacgccacccccggtctctcccgcaaccccgtcggcggccacgtcccggtggccggtggc
ctccactccgtcggtctggcctacgcccgcgacctcgcggccgaggccgtgcaggtcttc
gtcgccaacccgcgcggctgggcgacgcccgccggcaatccgcggcaggacgaggagttc
cgcgcggcctgtgccgccgagtcgatccccgcgtacgtccatgccccgtatctgatcaac
ttcggctcgcacaccgaggcgaccgtggagaagtccgtggagtcgctgcggcactcgctg
cgcagggggcgcgagatcggcgccctgggcgtggtggtgcacaccgggagcgccaccggc
ggacgggagcggtccgtcgccctcgcccaggtgcgggagcatctgctgcccctgctcgac
gagctgacccacgacgacgacccgtatctgctcctggagtcgaccgcgggtcagggcgcc
tccctgtgctcccggacctgggacttcgggccgtacttcgaggcgctggacgcccacccg
aagctgggcgtgtgcctggacacgtgtcacatcttcgcggcgggccatgacctcaccggg
ccgagcgggatgcaccagacgctcgatctgctggtcgacacggtcggcgaggggcgtctc
aagctgatccacgccaacgactccaaggacgtcgtcggcgcgcacaaggaccgccacgag
aacatcggctccggccacataggcgaggacccgttccgcgctctgatgacccacccggcc
accgagggcgtccctctgatcatcgagacgcccggcggaaaggagggccacgcggcggac
gtggagcagctcaagaagctccgcgacggctga

DBGET integrated database retrieval system