KEGG   Streptomyces avermitilis: SAVERM_6297
Entry
SAVERM_6297       CDS       T00126                                 

Gene name
pgk
Definition
(GenBank) putative phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00002  Glycolysis, core module involving three-carbon compounds
sma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_6297 (pgk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_6297 (pgk)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     SAVERM_6297 (pgk)
Exosome [BR:sma04147]
 Exosomal proteins
  Proteins found in most exosomes
   SAVERM_6297 (pgk)
SSDB
Motif
Pfam: PGK
Other DBs
NCBI-ProteinID: BAC74008
NITE: SAV6297
UniProt: Q829W2
Position
7560846..7562057
AA seq 403 aa
MKTIDELLAEGVDGKRVFVRADLNVPLADGLITDDGRIRAVLPTVKALAEAGAKVVVASH
LGRPKGAPDPAFSLLPAAERLGELLGAPVAFAQDTVGPAAHDAVNGLQPGQVAVIENLRF
NAGETSKDDAERGAFADRLAALADIYVGDGFGAVHRKHASVYDLPARLPHYAGYLIATEV
NVLKKLTEDVKRPYVVALGGAKVSDKLAVIDQLLGKADRLLIGGGMAYTFLKAKGYEVGI
SLLQEDQIPTVKEYMERAEKNGVELVLPVDVLVSTEFPDLKTKAPANPTTVAADAIPADQ
EGLDIGPETRKLYASKLADAATVFWNGPMGVFEHPDYAEGTKAVAQALVDSQAFTVVGGG
DSAAAVRILGFDETAFGHISTGGGASLEYLEGKTLPGLAALED
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgaagacgatcgacgaacttctcgccgaaggcgtggacggcaagcgggtcttcgtccgc
gccgacctgaacgtgccgctggccgacggcctcatcaccgacgacggccgcatccgcgcc
gtcctgccgacggtcaaggcgctggccgaggccggtgccaaggtggtcgtcgcctcgcac
ctgggccgccccaagggcgccccggacccggccttctccctgctgcccgcggcggagcgg
ctcggtgaactcctcggcgcgcccgtcgcgttcgcccaggacaccgtgggccccgccgcc
cacgacgccgtgaacggcctccagcccggccaggtagcggtcatcgagaacctgcgcttc
aacgcgggcgagacgtccaaggacgacgccgagcgcggcgcgttcgccgaccggctggcg
gccctggccgacatctacgtgggcgacggtttcggcgccgtgcaccgcaagcacgcctcc
gtgtacgacctcccggcacgcctgccgcactacgcgggctacctcatcgccaccgaggtc
aacgtcctgaagaagctcaccgaggacgtcaagcgcccctacgtggtcgcactcggcggc
gccaaggtctccgacaagctcgccgtcatcgaccagctgctcggcaaggccgaccgcctg
ctgatcggcggcggcatggcctacaccttcctcaaggccaagggctacgaggtcggcatc
tccctcctccaggaggaccagatcccgaccgtcaaggagtacatggagcgcgcggagaag
aacggcgtcgagctggtcctccccgtcgacgtgctggtctccacggagttcccggacctc
aagacgaaggccccggccaaccccaccaccgtcgccgcggacgccatcccggccgaccag
gagggtctcgacatcggtcctgagacccgcaagctgtacgcatcgaagctcgccgacgcg
gccaccgtcttctggaacggccccatgggcgtcttcgagcaccccgactacgccgagggc
accaaggcggtcgcccaggccctcgtcgactcccaggccttcacggtcgtcggcggtggc
gactccgccgcggccgtccgcatcctgggcttcgacgagacggcattcggccacatctcg
accggcggcggcgcctccctcgaatacctcgagggcaagacgctccccggccttgccgca
ctggaggactga

DBGET integrated database retrieval system