KEGG   Streptomyces avermitilis: SAVERM_6298
Entry
SAVERM_6298       CDS       T00126                                 

Gene name
tpiA
Definition
(GenBank) putative triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00051  Fructose and mannose metabolism
sma00562  Inositol phosphate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00002  Glycolysis, core module involving three-carbon compounds
sma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_6298 (tpiA)
   00051 Fructose and mannose metabolism
    SAVERM_6298 (tpiA)
   00562 Inositol phosphate metabolism
    SAVERM_6298 (tpiA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_6298 (tpiA)
Enzymes [BR:sma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAVERM_6298 (tpiA)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAVERM_6298 (tpiA)
  Exosomal proteins of bladder cancer cells
   SAVERM_6298 (tpiA)
  Exosomal proteins of melanoma cells
   SAVERM_6298 (tpiA)
SSDB
Motif
Pfam: TIM
Other DBs
NCBI-ProteinID: BAC74009
NITE: SAV6298
UniProt: Q829W1
Position
7562063..7562839
AA seq 258 aa
MTSRMPLMAGNWKMNLNHLEAIAHVQKLAFALADKDYEACEVAVLPPYTDLRSVQTLVDG
DKLKIKYGAQDVSAHDSGAYTGEISGSMLAKLKCTYVAVGHSERRQYHHETDEIVNAKVK
ASFRHGLIPILCVGEELEVREAGNHVTHTLTQVEGGLKDVPAEQAETIVIAYEPVWAIGT
GKVCGADDAQEVCAAIRAKLAELYSQELADQVRIQYGGSVKSGNVAEIMAKPDIDGALVG
GASLDADEFVKIARFRDQ
NT seq 777 nt   +upstreamnt  +downstreamnt
gtgacttcgcgcatgccgctgatggcgggcaactggaagatgaacctcaaccacctcgag
gccatcgcccacgtccagaagctcgccttcgccctggccgacaaggactacgaggcctgc
gaggtcgccgtcctgccgccctacaccgacctgcgctccgtgcagaccctggtcgacggc
gacaagctcaagatcaagtacggcgcccaggacgtctcggcgcacgactccggcgcctac
accggcgagatctccggctcgatgctggccaagctcaagtgcacgtacgtggcggtcggc
cactccgagcgccggcagtaccaccacgagaccgacgagatcgtcaacgccaaggtcaag
gcctccttcaggcacggcctgatcccgatcctgtgcgtcggcgaggagctggaggtgcgc
gaggcgggcaaccacgtcacgcacacgctcacccaggtcgagggcggcctcaaggacgtc
ccggccgagcaggccgagaccatcgtgatcgcgtacgagcccgtctgggccatcggcacc
ggcaaggtctgcggcgccgacgacgcccaggaagtctgcgcggccatccgcgccaagctc
gccgagctgtactcccaggagctggccgaccaggtccgcatccagtacggcggctccgtg
aagtccgggaacgtcgcggagatcatggcgaagcccgacatcgacggcgccctggtcggc
ggtgcctcgctcgacgccgacgagttcgtcaagatcgcgcgcttccgcgaccagtga

DBGET integrated database retrieval system