KEGG   Streptomyces avermitilis: SAVERM_6486Help
Entry
SAVERM_6486       CDS       T00126                                 

Definition
(GenBank) putative 3-methyladenine DNA glycosylase
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_6486
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6486
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     SAVERM_6486
DNA repair and recombination proteins [BR:sma03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAVERM_6486
 Prokaryotic type
     SAVERM_6486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pur_DNA_glyco
Motif
Other DBs
NCBI-ProteinID: BAC74197
NITE: SAV6486
UniProt: Q829C5
Position
7764232..7764873
Genome map
AA seq 213 aa AA seqDB search
MIAAPDRTPLTREFFARPVLDVAPDLLGRVLVRTTPDGPIELRVTEVEAYDGPSDPGSHA
YRGRTARNGVMFGPPGHVYVYFTYGMWHCMNLVCGPEGRASAVLLRAGEIIEGAELARTR
RLSARNDKELAKGPARLATALEVDRALDGTDACAPEGGPLTLLSGTPVPPDQVRNGPRTG
VSGDGGVHPWRFWIDNDPTVSPYRAHTPRRRRT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcggcccctgaccgtacgcccctcacccgggagttcttcgcccgacccgtcctt
gacgtcgccccggacctcctcggacgcgtcctcgtccgcacgaccccggacggtccgatc
gaactgcgcgtaaccgaggtcgaggcatacgacggcccgagcgatcccggctcccacgca
tatcgcggccgcacggcccgcaacggcgtgatgttcggtccgcccggccatgtgtacgtc
tacttcacctacggcatgtggcactgcatgaacctggtgtgcggtccggagggccgagcg
agcgcggtcctgctgcgggccggcgagatcatcgagggcgcggagctcgcgcgcacacgt
cgactctcggcccgcaacgacaaggaactggccaaaggaccggcacgtctggccacggcg
ctggaggtggaccgcgcactcgacggcaccgacgcatgcgccccggagggcgggccgctg
accctgctgtcgggcacgcccgtgccccccgaccaggtgcgcaacggtccgcgcaccgga
gtgtccggtgacggaggggtccacccgtggcgcttctggatcgacaacgaccccacggtg
agcccctatcgggcccatacgccccgacgccgacgaacttga

DBGET integrated database retrieval system