KEGG   Streptomyces avermitilis: SAVERM_6490
Entry
SAVERM_6490       CDS       T00126                                 

Definition
(GenBank) putative hydrolase
  KO
K06117  glycerol-1-phosphatase [EC:3.1.3.21]
Organism
sma  Streptomyces avermitilis
Pathway
sma00561  Glycerolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_6490
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.21  glycerol-1-phosphatase
     SAVERM_6490
SSDB
Motif
Pfam: Hydrolase_6 GNAT_like Hydrolase_like Hydrolase
Other DBs
NCBI-ProteinID: BAC74201
NITE: SAV6490
UniProt: Q829C1
Position
7774522..7775550
AA seq 342 aa
MSQTVRTRPEGSTQALSEAYDTALLDLDGVVYAGGNAIAHAVESLGTARAGGMHLAYVTN
NALRTPDAVADHLTELGIPTGPSDVITSAQAVARLISEQVPAGARVLVIGGEGLRVALRE
RGLEPVDSAEDDPAAVVQGYGGPELPWGRFAEASYAIARGVPWFASNTDLTIPSARGIAP
GNGAAVEVVRIATGAEPQVAGKPLPPMHRETILRTGAERPLVVGDRLDTDIEGAFNGEVD
SLLVLTGVTDGAQLLAAPPRHRPTYVDADLRGLLTGQPEVVEAGDGFRCGGWTATAGSER
LELAGEGEAMDGLRALCAAAWTAAGEGSCELDGGKALARLGL
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgagccagaccgtcaggacgcggcccgagggcagtacgcaggccctgagtgaggcgtac
gacacggcgctgctcgacctcgacggggtggtgtacgcggggggaaacgcgatcgctcat
gccgttgagtcgctcggcacggcccgcgcgggcgggatgcacctcgcatacgttacgaac
aacgcgctgcggacgcccgacgccgtggccgatcacctcacggaactggggataccgacc
gggccctccgacgtcatcacgtcggcgcaggccgtcgcccggctgatcagcgagcaggtg
cccgcgggcgcgcgtgtgctggtgatcggtggcgagggactgcgggtggcgctgcgggag
cgcgggctggagccggtcgattcggccgaggacgacccggcggccgtcgtacagggctac
ggcggtcccgagctgccctggggacgtttcgcggaggcgtcctacgccatcgcgcgcggg
gtgccgtggttcgcgtccaacaccgatctgacgattccgagtgcgcgtgggatcgctccg
ggcaacggggcggcggtggaggtcgtacggatagcgaccggcgccgagccgcaggtggcg
ggcaagccgctgcccccgatgcaccgcgagacgattctgcgcaccggcgccgagcggccg
ctggtggtcggggaccggctggacacggacatcgagggcgcgttcaacggcgaggtggac
tcgctgctcgtcctgaccggcgtgaccgacggcgcccagctcctggcggcgccgccgcgg
caccggccgacgtatgtcgacgcggacctgcgcggactgctgaccgggcagccggaggtc
gtcgaggccggcgacgggtttcgctgcggtggctggaccgcgacagccggaagtgaacgg
ctggagctcgcgggcgagggagaggccatggacgggctgcgggcgctgtgcgcggcggcc
tggacggctgcgggcgagggctcgtgcgagctggacggggggaaggcgctggcgcggctg
gggctttga

DBGET integrated database retrieval system